|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT5G50370 | AT | Annotation by Michelle Graham. TAIR10: Adenylate kinase family protein | chr5:20509382-20510631 REVERSE LENGTH=248 | SoyBase | E_val: 2.00E-37 | ISS |
GO:0006139 | GO-bp | Annotation by Michelle Graham. GO Biological Process: nucleobase-containing compound metabolic process | SoyBase | N/A | ISS |
GO:0009061 | GO-bp | Annotation by Michelle Graham. GO Biological Process: anaerobic respiration | SoyBase | N/A | ISS |
GO:0009117 | GO-bp | Annotation by Michelle Graham. GO Biological Process: nucleotide metabolic process | SoyBase | N/A | ISS |
GO:0046939 | GO-bp | Annotation by Michelle Graham. GO Biological Process: nucleotide phosphorylation | SoyBase | N/A | ISS |
GO:0005737 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm | SoyBase | N/A | ISS |
GO:0005739 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion | SoyBase | N/A | ISS |
GO:0005774 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane | SoyBase | N/A | ISS |
GO:0004017 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: adenylate kinase activity | SoyBase | N/A | ISS |
GO:0005507 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: copper ion binding | SoyBase | N/A | ISS |
GO:0005524 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ATP binding | SoyBase | N/A | ISS |
GO:0016776 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: phosphotransferase activity, phosphate group as acceptor | SoyBase | N/A | ISS |
GO:0019205 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: nucleobase-containing compound kinase activity | SoyBase | N/A | ISS |
PTHR23359 | Panther | ADENYLATE KINASE | JGI | ISS | |
PF00406 | PFAM | Adenylate kinase | JGI | ISS | |
PF05191 | PFAM | Adenylate kinase, active site lid | JGI | ISS | |
UniRef100_I1MUN0 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1MUN0_SOYBN | SoyBase | E_val: 2.00E-46 | ISS |
UniRef100_I1MUN1 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Adenylate kinase 17 n=1 Tax=Glycine max RepID=I1MUN1_SOYBN | SoyBase | E_val: 1.00E-44 | ISS |
Glyma02g24818 not represented in the dataset |
Glyma02g24818 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma.02g164900 | Wm82.a2.v1 | IGC | As supplied by JGI |
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma02g24818.1 sequence type=CDS gene model=Glyma02g24818 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGAAAAAACCTTCATGTCAGAAAGGTTTCATTCTTGATGGTTTTCCAAGAACCGTGGTCCAAGCACAGAAGCTTGATGAGATGCTGCAAAACCAAGGAGTTAAAGTTAATAAGTGTAGAACCTACCATACAAAATTTGCTCCTCCTAAGGTTCTTGGTGTTGATGATGTTACTGGTGAACCACTTATCCAGTGCAAGGATGACACTGCAGCTGTTCTTAAGTCAAGACTGGAGGCATTTCACAAGCAAACTGAATCGGTATGA
>Glyma02g24818.1 sequence type=predicted peptide gene model=Glyma02g24818 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MKKPSCQKGFILDGFPRTVVQAQKLDEMLQNQGVKVNKCRTYHTKFAPPKVLGVDDVTGEPLIQCKDDTAAVLKSRLEAFHKQTESV*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||