SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g24818): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g24818): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g24818

Feature Type:gene_model
Chromosome:Gm02
Start:25630723
stop:25631714
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma02g24818
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G50370AT Annotation by Michelle Graham. TAIR10: Adenylate kinase family protein | chr5:20509382-20510631 REVERSE LENGTH=248 SoyBaseE_val: 2.00E-37ISS
GO:0006139GO-bp Annotation by Michelle Graham. GO Biological Process: nucleobase-containing compound metabolic process SoyBaseN/AISS
GO:0009061GO-bp Annotation by Michelle Graham. GO Biological Process: anaerobic respiration SoyBaseN/AISS
GO:0009117GO-bp Annotation by Michelle Graham. GO Biological Process: nucleotide metabolic process SoyBaseN/AISS
GO:0046939GO-bp Annotation by Michelle Graham. GO Biological Process: nucleotide phosphorylation SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0004017GO-mf Annotation by Michelle Graham. GO Molecular Function: adenylate kinase activity SoyBaseN/AISS
GO:0005507GO-mf Annotation by Michelle Graham. GO Molecular Function: copper ion binding SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016776GO-mf Annotation by Michelle Graham. GO Molecular Function: phosphotransferase activity, phosphate group as acceptor SoyBaseN/AISS
GO:0019205GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleobase-containing compound kinase activity SoyBaseN/AISS
PTHR23359Panther ADENYLATE KINASE JGI ISS
PF00406PFAM Adenylate kinase JGI ISS
PF05191PFAM Adenylate kinase, active site lid JGI ISS
UniRef100_I1MUN0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1MUN0_SOYBN SoyBaseE_val: 2.00E-46ISS
UniRef100_I1MUN1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Adenylate kinase 17 n=1 Tax=Glycine max RepID=I1MUN1_SOYBN SoyBaseE_val: 1.00E-44ISS

Expression Patterns of Glyma02g24818
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g24818 not represented in the dataset
Glyma02g24818 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g24818 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g164900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma02g24818
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma02g24818
>Glyma02g24818.1   sequence type=CDS   gene model=Glyma02g24818   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAAAAACCTTCATGTCAGAAAGGTTTCATTCTTGATGGTTTTCCAAGAACCGTGGTCCAAGCACAGAAGCTTGATGAGATGCTGCAAAACCAAGGAGTTAAAGTTAATAAGTGTAGAACCTACCATACAAAATTTGCTCCTCCTAAGGTTCTTGGTGTTGATGATGTTACTGGTGAACCACTTATCCAGTGCAAGGATGACACTGCAGCTGTTCTTAAGTCAAGACTGGAGGCATTTCACAAGCAAACTGAATCGGTATGA
Predicted protein sequences of Glyma02g24818
>Glyma02g24818.1   sequence type=predicted peptide   gene model=Glyma02g24818   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKKPSCQKGFILDGFPRTVVQAQKLDEMLQNQGVKVNKCRTYHTKFAPPKVLGVDDVTGEPLIQCKDDTAAVLKSRLEAFHKQTESV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo