SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma02g23725

Feature Type:gene_model
Chromosome:Gm02
Start:24251520
stop:24251998
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G26380AT Annotation by Michelle Graham. TAIR10: Melibiase family protein | chr3:9660140-9663145 FORWARD LENGTH=647 SoyBaseE_val: 3.00E-30ISS
GO:0005975GO-bp Annotation by Michelle Graham. GO Biological Process: carbohydrate metabolic process SoyBaseN/AISS
GO:0005990GO-bp Annotation by Michelle Graham. GO Biological Process: lactose catabolic process SoyBaseN/AISS
GO:0006499GO-bp Annotation by Michelle Graham. GO Biological Process: N-terminal protein myristoylation SoyBaseN/AISS
GO:0009311GO-bp Annotation by Michelle Graham. GO Biological Process: oligosaccharide metabolic process SoyBaseN/AISS
GO:0016139GO-bp Annotation by Michelle Graham. GO Biological Process: glycoside catabolic process SoyBaseN/AISS
GO:0046477GO-bp Annotation by Michelle Graham. GO Biological Process: glycosylceramide catabolic process SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005618GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell wall SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0009505GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plant-type cell wall SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0004553GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, hydrolyzing O-glycosyl compounds SoyBaseN/AISS
GO:0004557GO-mf Annotation by Michelle Graham. GO Molecular Function: alpha-galactosidase activity SoyBaseN/AISS
UniRef100_G7J357UniRef Annotation by Michelle Graham. Most informative UniRef hit: Alpha-galactosidase n=1 Tax=Medicago truncatula RepID=G7J357_MEDTR SoyBaseE_val: 8.00E-58ISS
UniRef100_I1LNG2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1LNG2_SOYBN SoyBaseE_val: 2.00E-75ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g23725 not represented in the dataset

Glyma02g23725 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.09g095100 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma02g23725.1   sequence type=CDS   gene model=Glyma02g23725   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACTCTGTGGTCGATGGCAAAGGCTCCCCTTATGTATGCAGGGGATGTTCGGAAGATTGATCCTAGCACATATGATGTTATCACAAATCCTACCCTTTTGGAGATTAATTCTTTCAGCTCAAATAACATGGAGTTTCCTTATATCACAAGTGTGAATAGTGAAGATCAGGATCTTGGTAAGCAAATGAGAAGAAGCAGCAAAGAAATAAAAACAACCGATACTCATTCATTAGGCCTCACAAGCTGCACTGAGTCAAAGGCAAGTGGTTTGGCTAGTGGAAGTCTTAACCAATATCTTGAAAGAATATGTTGGAAAAGGAGTTTAGGAAACAAGCATCTTGCCCCCTTCTGTGTGCACAAGAGAGAACTTTACTTCACATTGTAA

>Glyma02g23725.1   sequence type=predicted peptide   gene model=Glyma02g23725   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTLWSMAKAPLMYAGDVRKIDPSTYDVITNPTLLEINSFSSNNMEFPYITSVNSEDQDLGKQMRRSSKEIKTTDTHSLGLTSCTESKASGLASGSLNQYLERICWKRSLGNKHLAPFCVHKRELYFTL*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo