Glyma02g21170 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g21170

Feature Type:	gene_model
Chromosome:	Gm02
Start:	20177237
stop:	20177721
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma02g21170

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G24940	AT	Annotation by Michelle Graham. TAIR10: membrane-associated progesterone binding protein 2 \| chr2:10609447-10609749 FORWARD LENGTH=100	SoyBase	E_val: 6.00E-35	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0020037	GO-mf	Annotation by Michelle Graham. GO Molecular Function: heme binding	SoyBase	N/A	ISS
PTHR10281	Panther	MEMBRANE ASSOCIATED PROGESTERONE RECEPTOR-RELATED	JGI		ISS
PF00173	PFAM	Cytochrome b5-like Heme/Steroid binding domain	JGI		ISS
UniRef100_B9RNT1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Steroid binding protein, putative n=1 Tax=Ricinus communis RepID=B9RNT1_RICCO	SoyBase	E_val: 2.00E-34	ISS
UniRef100_I1JFP6	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1JFP6_SOYBN	SoyBase	E_val: 3.00E-44	ISS

Expression Patterns of Glyma02g21170

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g21170 not represented in the dataset	Glyma02g21170 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g21170 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma02g21170

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma02g21170

Limit To All Plant Sequences

>Glyma02g21170.1   sequence type=CDS   gene model=Glyma02g21170   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CCGTCGTGCCGTAGGCTATCCCGCCGTGGTTGCCAGCTGTGTCGTGAGAGTGAGAAGCAGAGGGTAACGAGGAAGGTGAAGTGGTTCAATGACCAGAAGGGAGTGGGTCGCGTCTACGACGTCAGCACTGGAAAATCCTTTTACGGCCCCAGCGGCCCCTACGCCATGTTTGCCGTCAAAGACGCCAGCAGAGCCCTGGCGAAGATGAGCAAGAACGACGATGACATCTCCCCCTCCCTCGACGACCTCTCTGACAAGGAGATCGGTGTTCTCAACGACTGGGAGAACAAATTCCAAGCTAAGTACCCTGTGGTTGCTCGTGTTCTCAATTAA

Predicted protein sequences of Glyma02g21170

Limit To All Plant Sequences

>Glyma02g21170.1   sequence type=predicted peptide   gene model=Glyma02g21170   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
PSCRRLSRRGCQLCRESEKQRVTRKVKWFNDQKGVGRVYDVSTGKSFYGPSGPYAMFAVKDASRALAKMSKNDDDISPSLDDLSDKEIGVLNDWENKFQAKYPVVARVLN*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain