Glyma02g18545 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g18545): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g18545): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g18545

Feature Type:	gene_model
Chromosome:	Gm02
Start:	17324317
stop:	17328920
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma02g18545

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G39170	AT	Annotation by Michelle Graham. TAIR10: unknown protein; CONTAINS InterPro DOMAIN/s: Protein of unknown function NEP (InterPro:IPR019320); Has 57 Blast hits to 57 proteins in 26 species: Archae - 0; Bacteria - 0; Metazoa - 19; Fungi - 0; Plants - 34; Viruses - 0; Other Eukaryotes - 4 (source: NCBI BLink). \| chr2:16334726-16335421 REVERSE LENGTH=231	SoyBase	E_val: 2.00E-42	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
KOG4523	KOG	Uncharacterized conserved protein	JGI		ISS
PTHR21146	Panther	MEF2B PROTEIN	JGI		ISS
PF10167	PFAM	Uncharacterised conserved protein	JGI		ISS
UniRef100_UPI0002337067	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI0002337067 related cluster n=1 Tax=unknown RepID=UPI0002337067	SoyBase	E_val: 1.00E-83	ISS

Expression Patterns of Glyma02g18545

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g18545 not represented in the dataset	Glyma02g18545 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g18545 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.02g159000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma02g18545

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma02g18545

Limit To All Plant Sequences

>Glyma02g18545.1   sequence type=CDS   gene model=Glyma02g18545   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCATGGATTCTCCCCTGTTGATGGTTTTGTGGAGATAAGCAATTGCTTGGCAGAAGTGATTAAATATGTGGGTAATGAATCGTCTACTGGTCTCTTCTTTATCCAACATCACACCCAAAACGCAGTCCCCAATGTCATCAAACTTAAGAACAACATTATTGACAAGTCTCATGAAACAACTTTGCACACCGAAGATTTGGAGGATTCCGTCTCAATGGTGAGATCAATGAAAGAGTGTGGATTCCCCATAGCTGATGAGATGATTGGAGACATAAAAAAATCTCTGGCAATGATGACAACCAAGCATCCAAAAGGAAGGCTAATCCATCGGTCGACATCATATTTTCAGACTGACAGCTAA

Predicted protein sequences of Glyma02g18545

Limit To All Plant Sequences

>Glyma02g18545.1   sequence type=predicted peptide   gene model=Glyma02g18545   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MHGFSPVDGFVEISNCLAEVIKYVGNESSTGLFFIQHHTQNAVPNVIKLKNNIIDKSHETTLHTEDLEDSVSMVRSMKECGFPIADEMIGDIKKSLAMMTTKHPKGRLIHRSTSYFQTDS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain