SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g17371): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g17371): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g17371

Feature Type:gene_model
Chromosome:Gm02
Start:15655950
stop:15657832
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma02g17371
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G15802AT Annotation by Michelle Graham. TAIR10: heat shock factor binding protein | chr4:8986864-8988339 REVERSE LENGTH=86 SoyBaseE_val: 2.00E-34ISS
GO:0009408GO-bp Annotation by Michelle Graham. GO Biological Process: response to heat SoyBaseN/AISS
GO:0048316GO-bp Annotation by Michelle Graham. GO Biological Process: seed development SoyBaseN/AISS
GO:0070370GO-bp Annotation by Michelle Graham. GO Biological Process: cellular heat acclimation SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0031072GO-mf Annotation by Michelle Graham. GO Molecular Function: heat shock protein binding SoyBaseN/AISS
KOG4117 KOG Heat shock factor binding protein JGI ISS
PTHR19424Panther HEAT SHOCK FACTOR BINDING PROTEIN 1 JGI ISS
PF06825PFAM Heat shock factor binding protein 1 JGI ISS
UniRef100_C6TFS4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TFS4_SOYBN SoyBaseE_val: 6.00E-51ISS
UniRef100_Q6ST18UniRef Annotation by Michelle Graham. Most informative UniRef hit: Heat shock factor binding protein 2 n=1 Tax=Zea mays RepID=Q6ST18_MAIZE SoyBaseE_val: 4.00E-18ISS

Expression Patterns of Glyma02g17371
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g17371 not represented in the dataset
Glyma02g17371 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma02g17371
ParalogEvidenceComments
Glyma10g02430 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma02g17371 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma02g17371
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma02g17371
>Glyma02g17371.1   sequence type=CDS   gene model=Glyma02g17371   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CTCGTGAGATCAGAATATCAGATCGAATTTAAACGGGTCATATTCGCATTTTCATTTCATTTTGAATTGAAACCGCGGAGAGTTTGCTGCTACATCGATCATCATCACCTCATGGACGGACACGATCCACAAGACCCAAAGCAGAGCCCTGCTGACATGACTGCCTTTGTGCAAAATCTTCTTCAGCAGATGCAAAATAGGTTCCAGACAATGTCCGACTCCATTGTTACAAAGAATATCCTTTTGTTTTGTCGCATAAATGAGTTGGAACAAAGCATCAATGACCTGAGAGCAGAGATGGGAGTGGAGTCCTCTCCATCACCTGCAGCCCCTGCTAAGCTAACGGAGGAGATAACCAAAGAAGAGGGTTCAGCTTAA
Predicted protein sequences of Glyma02g17371
>Glyma02g17371.1   sequence type=predicted peptide   gene model=Glyma02g17371   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
LVRSEYQIEFKRVIFAFSFHFELKPRRVCCYIDHHHLMDGHDPQDPKQSPADMTAFVQNLLQQMQNRFQTMSDSIVTKNILLFCRINELEQSINDLRAEMGVESSPSPAAPAKLTEEITKEEGSA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo