|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT4G13420 | AT | Annotation by Michelle Graham. TAIR10: high affinity K+ transporter 5 | chr4:7797038-7802174 REVERSE LENGTH=785 | SoyBase | E_val: 1.00E-21 | ISS |
| GO:0006813 | GO-bp | Annotation by Michelle Graham. GO Biological Process: potassium ion transport | SoyBase | N/A | ISS |
| GO:0071805 | GO-bp | Annotation by Michelle Graham. GO Biological Process: potassium ion transmembrane transport | SoyBase | N/A | ISS |
| GO:0005886 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane | SoyBase | N/A | ISS |
| GO:0016020 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: membrane | SoyBase | N/A | ISS |
| GO:0009674 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: potassium:sodium symporter activity | SoyBase | N/A | ISS |
| GO:0015079 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: potassium ion transmembrane transporter activity | SoyBase | N/A | ISS |
| PF02705 | PFAM | K+ potassium transporter | JGI | ISS | |
| UniRef100_B9I9U3 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Predicted protein n=1 Tax=Populus trichocarpa RepID=B9I9U3_POPTR | SoyBase | E_val: 4.00E-28 | ISS |
| UniRef100_G7KRU2 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Potassium transporter n=1 Tax=Medicago truncatula RepID=G7KRU2_MEDTR | SoyBase | E_val: 5.00E-28 | ISS |
|
Glyma02g17323 not represented in the dataset |
Glyma02g17323 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.02g154200 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma02g17323.1 sequence type=CDS gene model=Glyma02g17323 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGCCTTCTGAAGTAATGGTGGAGAGTATGGAAAGCAATGGAGGAAACGTTGAAAATACAGAGCAGCACCATCATTTGCCAGTTTCTGATCCTCATGGGCTCATGGGGAAGAAGCTTTCATGGCAAAAGTTTCCTAGAAATGATTCTCTCGACATGGAATCCCGCAGCTTCCCTACATCCTCTCATGCCTCTATAATGCCAGTGATTATGCATCTAGCGTTTCAAAGCCTCGGAATTGTATATGGTGACATGGGAACATCACCGTTATATGTGTATGCAAGCACCTTCGTGGATGGCATAAAGCACAACGATGACATTTTGGGTGTTCTTTCGTTGATCTTCTAA
>Glyma02g17323.1 sequence type=predicted peptide gene model=Glyma02g17323 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MPSEVMVESMESNGGNVENTEQHHHLPVSDPHGLMGKKLSWQKFPRNDSLDMESRSFPTSSHASIMPVIMHLAFQSLGIVYGDMGTSPLYVYASTFVDGIKHNDDILGVLSLIF*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||