SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g17316

Feature Type:gene_model
Chromosome:Gm02
Start:15621470
stop:15622853
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma02g17316
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G13420AT Annotation by Michelle Graham. TAIR10: high affinity K+ transporter 5 | chr4:7797038-7802174 REVERSE LENGTH=785 SoyBaseE_val: 6.00E-53ISS
GO:0006813GO-bp Annotation by Michelle Graham. GO Biological Process: potassium ion transport SoyBaseN/AISS
GO:0071805GO-bp Annotation by Michelle Graham. GO Biological Process: potassium ion transmembrane transport SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0009674GO-mf Annotation by Michelle Graham. GO Molecular Function: potassium:sodium symporter activity SoyBaseN/AISS
GO:0015079GO-mf Annotation by Michelle Graham. GO Molecular Function: potassium ion transmembrane transporter activity SoyBaseN/AISS
PF02705PFAM K+ potassium transporter JGI ISS
UniRef100_G7KRU2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Potassium transporter n=1 Tax=Medicago truncatula RepID=G7KRU2_MEDTR SoyBaseE_val: 3.00E-84ISS
UniRef100_G7KRU2UniRef Annotation by Michelle Graham. Best UniRef hit: Potassium transporter n=1 Tax=Medicago truncatula RepID=G7KRU2_MEDTR SoyBaseE_val: 3.00E-84ISS

Expression Patterns of Glyma02g17316
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g17316 not represented in the dataset
Glyma02g17316 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g17316 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g154100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma02g17316
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma02g17316
>Glyma02g17316.1   sequence type=CDS   gene model=Glyma02g17316   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCAGATAAGCATGTGCTCTGTAACATACCCTGCTCTCTTACTTGCCTACACTGGACAAGCCTCCTTTCTTCGCCAAAACAATGATCTTGTTTCAGACACTTTCTACAAGTCCATACCACCCATGATCTCTGGGACTTTCTCTATCATCCAACAATCCCTCGCTCTTGGATGCTTTCCTTGTGTGAAGATAGTGCATACATCCGCCAAGTATGAAGGACAAGTTTACATACCCGAAATCAATTTCATTCTCTTGATTGCATGTGTTGCAGTCACTGCTGGATTTAAAACTACCACAAAAATTGGGATAGCAGTGGTGTTTGTAATGACACTTACATCTGCTTTGCTAGTGTTAATCATGATCCTGATATGGAAGAGTCACATACTTTTGGTTATCAACTATGTGGTTGTTGAACTTATCTACTCAAGCTCGGTGTTATACAAATTTGGGTATCTTCCTCTGGCCTTCGCTGCAGTGCTAATGATCATCATGTACATTTGGAATGATGTGTATAGAAGGAATAGTGGAGGCAGCCCAATAAAGCGAGATTTCCAGTGA
Predicted protein sequences of Glyma02g17316
>Glyma02g17316.1   sequence type=predicted peptide   gene model=Glyma02g17316   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MQISMCSVTYPALLLAYTGQASFLRQNNDLVSDTFYKSIPPMISGTFSIIQQSLALGCFPCVKIVHTSAKYEGQVYIPEINFILLIACVAVTAGFKTTTKIGIAVVFVMTLTSALLVLIMILIWKSHILLVINYVVVELIYSSSVLYKFGYLPLAFAAVLMIIMYIWNDVYRRNSGGSPIKRDFQ*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo