SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g16890): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g16890): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g16890

Feature Type:gene_model
Chromosome:Gm02
Start:15224186
stop:15228141
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma02g16890
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G02980AT Annotation by Michelle Graham. TAIR10: endoplasmic reticulum auxin binding protein 1 | chr4:1319902-1321449 REVERSE LENGTH=198 SoyBaseE_val: 1.00E-98ISS
GO:0000910GO-bp Annotation by Michelle Graham. GO Biological Process: cytokinesis SoyBaseN/AISS
GO:0009826GO-bp Annotation by Michelle Graham. GO Biological Process: unidimensional cell growth SoyBaseN/AISS
GO:0032877GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of DNA endoreduplication SoyBaseN/AISS
GO:0045793GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of cell size SoyBaseN/AISS
GO:0051781GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of cell division SoyBaseN/AISS
GO:0005788GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum lumen SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0010011GO-mf Annotation by Michelle Graham. GO Molecular Function: auxin binding SoyBaseN/AISS
PF02041PFAM Auxin binding protein JGI ISS
UniRef100_B6VB01UniRef Annotation by Michelle Graham. Most informative UniRef hit: Auxin binding protein 1 n=1 Tax=Arachis hypogaea RepID=B6VB01_ARAHY SoyBaseE_val: 4.00E-110ISS
UniRef100_I3SVZ9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Lotus japonicus RepID=I3SVZ9_LOTJA SoyBaseE_val: 2.00E-110ISS

Expression Patterns of Glyma02g16890
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g16890 not represented in the dataset
Glyma02g16890 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g16890 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g150100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma02g16890
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma02g16890
>Glyma02g16890.2   sequence type=CDS   gene model=Glyma02g16890   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTAGAACGTTGTACGAGTCCGATTGTGTTGCTCTGTCTCTTCTCATTTTCTGCACTTACTCTAGCTTTTTCGCCATGCCCCCTCACTGGGTTACCGCTGGTGAGAAATATCAGTGAGATTCCTCAGGATAACTACGGTAGGGCTGGTCTCTCTCACATGACTGTTGCAGGTTCATTGTTGCATGGAATGAAAGAGGTTGAAGTATGGCTTCAAACATTTTCACCAGGAACACACACCCCAATTCATAGACATTCCTGTGAAGAAGTTTTCATTGTTCTCAAAGGGAGTGGCACTCTTTATCTTGCATCAGATTCACATGGAAGATACCCTGGAAAGCCACAGGAGCACTTCATCTTTCCAAATAGCACATTTCATATTCCTGTTAATGATGCTCATCAGCTTTGGAACACCAATGAGCACGAGGACTTACAGGTGCTTGTCATAATATCTCGTCCTCCAGTTAAAGTGTTTGTATACGAGGACTGGTCCGTGCCTCACACTGCAGCGAAAGTGAAATTCCCCTACTACTGGGATGAGCAATGTTATCAAGAACCTCCAAAAGATGAATTATGA
Predicted protein sequences of Glyma02g16890
>Glyma02g16890.2   sequence type=predicted peptide   gene model=Glyma02g16890   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVERCTSPIVLLCLFSFSALTLAFSPCPLTGLPLVRNISEIPQDNYGRAGLSHMTVAGSLLHGMKEVEVWLQTFSPGTHTPIHRHSCEEVFIVLKGSGTLYLASDSHGRYPGKPQEHFIFPNSTFHIPVNDAHQLWNTNEHEDLQVLVIISRPPVKVFVYEDWSVPHTAAKVKFPYYWDEQCYQEPPKDEL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo