SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma02g16766

Feature Type:gene_model
Chromosome:Gm02
Start:15122343
stop:15122789
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G63095AT Annotation by Michelle Graham. TAIR10: Tetratricopeptide repeat (TPR)-like superfamily protein | chr3:23315506-23316258 FORWARD LENGTH=250 SoyBaseE_val: 2.00E-16ISS
UniRef100_G8A041UniRef Annotation by Michelle Graham. Most informative UniRef hit: AAA ATPase containing von Willebrand factor type A n=1 Tax=Medicago truncatula RepID=G8A041_MEDTR SoyBaseE_val: 1.00E-51ISS
UniRef100_G8A041UniRef Annotation by Michelle Graham. Best UniRef hit: AAA ATPase containing von Willebrand factor type A n=1 Tax=Medicago truncatula RepID=G8A041_MEDTR SoyBaseE_val: 1.00E-51ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g16766 not represented in the dataset

Glyma02g16766 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma10g03050 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g148700 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma02g16766.1   sequence type=CDS   gene model=Glyma02g16766   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGAGAGTCAAGATTTTCAATTTAAAAACTATGGCTCTGACATTTGTGGCATTTGTGCCAAAGATGGAGAGCCAGATCATGCCACCAGTTATTCCTTTTCCACCACCATCTCTTCACCCACTTTGTTTATCCCAACTAGCACTAGTAAGCTATGCTTGTGCAATGTTGCCTCCAACCACAACACCACCACCTTCACCACTCACATCTCCACCCTCTCCTTCATCCCCAAGTGATGATGAGGGACACAGGAATGACCAAAATCATGGTCACCACCAAACTTCTCAAGAAGAAAACTGTTGCCGGTGGGCTAAGGAAATGGACAACCAATGTGTATGTGAATTCCTACTTCTATTGCCTCCCTTCCTTACTAGACCTTTGCATCAGTACTCAATCAGCATTGGAGAATCGTGTAATGCCACTTACTCGTGTGGTGGGCCTATATGA

>Glyma02g16766.1   sequence type=predicted peptide   gene model=Glyma02g16766   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKRVKIFNLKTMALTFVAFVPKMESQIMPPVIPFPPPSLHPLCLSQLALVSYACAMLPPTTTPPPSPLTSPPSPSSPSDDEGHRNDQNHGHHQTSQEENCCRWAKEMDNQCVCEFLLLLPPFLTRPLHQYSISIGESCNATYSCGGPI*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo