Glyma02g16766 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g16766

Feature Type:	gene_model
Chromosome:	Gm02
Start:	15122343
stop:	15122789
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma02g16766

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G63095	AT	Annotation by Michelle Graham. TAIR10: Tetratricopeptide repeat (TPR)-like superfamily protein \| chr3:23315506-23316258 FORWARD LENGTH=250	SoyBase	E_val: 2.00E-16	ISS
UniRef100_G8A041	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: AAA ATPase containing von Willebrand factor type A n=1 Tax=Medicago truncatula RepID=G8A041_MEDTR	SoyBase	E_val: 1.00E-51	ISS
UniRef100_G8A041	UniRef	Annotation by Michelle Graham. Best UniRef hit: AAA ATPase containing von Willebrand factor type A n=1 Tax=Medicago truncatula RepID=G8A041_MEDTR	SoyBase	E_val: 1.00E-51	ISS

Expression Patterns of Glyma02g16766

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g16766 not represented in the dataset	Glyma02g16766 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma02g16766

Paralog	Evidence	Comments
Glyma10g03050	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma02g16766 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.02g148700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma02g16766

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma02g16766

Limit To All Plant Sequences

>Glyma02g16766.1   sequence type=CDS   gene model=Glyma02g16766   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGAGAGTCAAGATTTTCAATTTAAAAACTATGGCTCTGACATTTGTGGCATTTGTGCCAAAGATGGAGAGCCAGATCATGCCACCAGTTATTCCTTTTCCACCACCATCTCTTCACCCACTTTGTTTATCCCAACTAGCACTAGTAAGCTATGCTTGTGCAATGTTGCCTCCAACCACAACACCACCACCTTCACCACTCACATCTCCACCCTCTCCTTCATCCCCAAGTGATGATGAGGGACACAGGAATGACCAAAATCATGGTCACCACCAAACTTCTCAAGAAGAAAACTGTTGCCGGTGGGCTAAGGAAATGGACAACCAATGTGTATGTGAATTCCTACTTCTATTGCCTCCCTTCCTTACTAGACCTTTGCATCAGTACTCAATCAGCATTGGAGAATCGTGTAATGCCACTTACTCGTGTGGTGGGCCTATATGA

Predicted protein sequences of Glyma02g16766

Limit To All Plant Sequences

>Glyma02g16766.1   sequence type=predicted peptide   gene model=Glyma02g16766   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKRVKIFNLKTMALTFVAFVPKMESQIMPPVIPFPPPSLHPLCLSQLALVSYACAMLPPTTTPPPSPLTSPPSPSSPSDDEGHRNDQNHGHHQTSQEENCCRWAKEMDNQCVCEFLLLLPPFLTRPLHQYSISIGESCNATYSCGGPI*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain