SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g16750): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g16750): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g16750

Feature Type:gene_model
Chromosome:Gm02
Start:15115808
stop:15117267
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G63110AT Annotation by Michelle Graham. TAIR10: isopentenyltransferase 3 | chr3:23318437-23319447 REVERSE LENGTH=336 SoyBaseE_val: 8.00E-102ISS
GO:0007131GO-bp Annotation by Michelle Graham. GO Biological Process: reciprocal meiotic recombination SoyBaseN/AISS
GO:0008033GO-bp Annotation by Michelle Graham. GO Biological Process: tRNA processing SoyBaseN/AISS
GO:0009691GO-bp Annotation by Michelle Graham. GO Biological Process: cytokinin biosynthetic process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009536GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plastid SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0009824GO-mf Annotation by Michelle Graham. GO Molecular Function: AMP dimethylallyltransferase activity SoyBaseN/AISS
GO:0016765GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring alkyl or aryl (other than methyl) groups SoyBaseN/AISS
GO:0052622GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP dimethylallyltransferase activity SoyBaseN/AISS
GO:0052623GO-mf Annotation by Michelle Graham. GO Molecular Function: ADP dimethylallyltransferase activity SoyBaseN/AISS
KOG1384 KOG tRNA delta(2)-isopentenylpyrophosphate transferase JGI ISS
PTHR11088Panther TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE TRANSFERASE-RELATED JGI ISS
PTHR11088:SF20Panther CYTOKININ SYNTHASE JGI ISS
PF01715PFAM IPP transferase JGI ISS
UniRef100_Q1W5W3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Adenylate isopentenyltransferase n=1 Tax=Lotus japonicus RepID=Q1W5W3_LOTJA SoyBaseE_val: 6.00E-175ISS
UniRef100_UPI0001BA6B2BUniRef Annotation by Michelle Graham. Best UniRef hit: UPI0001BA6B2B related cluster n=1 Tax=unknown RepID=UPI0001BA6B2B SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g16750 not represented in the dataset

Glyma02g16750 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma10g03060 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g148600 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma02g16750.1   sequence type=CDS   gene model=Glyma02g16750   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACCATCTCACTGTTTATGTGCAGAGTAACACAACCCATAATAAATGTTCCTTGCAGTGGGAAAAAACTGATCGTGAGGCAAATTGAGAAAGAGAAAGTAGTGGTTGTAATGGGAGCCACCGGAGCAGGGAAGTCAAGGCTTTCAATTGACCTAGCAACATGTTTTCCATCAGAAATCATAAACGCCGACAAAATCCAAGTCTTCGAAGGTCTAGACATAGTCACAAACAAAATCTCCAAGGAAGAGCAACGCGGGGTTCCGCACCACTTACTAGGAACAATAAAGCCCAACATGGATTTCAGCGTCAACGATTTCTGTGACACGTCATCAGAGGCCATTGACTCAATCACGAGGTGCCAGAAGCTTCCAATCGTCGTTGGAGGCTCAAACTCGTATCTGGAGGCCCTCATGGACGACGACGATTACAAGTTCCGATCGCGCTACGATATTCTCTGCCTCTGGGTTGACGTGGAAATGTCCGTGCTTAAGTCCTACGTGGCAGACCGTGTCGACCACATGTTTTATAAAGGAATGGTCGATGAGCTGAGACCGTTTTATAGTCCCAACGGGGATTACTCGCGAGGGGTGAAAAGGGCAATTGGGGTGCCCGAGTTCCACGAGTATTTTGGGAGGGAAGAGGTTGCTGACGAGGAGACAAAACAGAGGTTGTTGGAACAAGCGGTTAAGGAAATCAAACTGAACACGTGCAAGCTAGCGATGAAGCAGTTGGGGAAGATTCGTAGGCTCAGGAACGTTAAGAGATGGCATATTCATCGATTGGATGCTACGCCCGTCTTCCGAATGCGTGGGGAAGAAGCCAACGATGCTTGGAAGAGGCTGGTGGCAAAGCCTAGTGCTTTGATCGTTGCTCGCTTTCTCTATAATAACAACTCCAAAAATAATGCCAACGTTGTTTCTGGTTCTGGACTTAGAGTGCAACCAGCTGCTTCAGAGAGTGTTCTCGCTGCCGCAACTTGCTAG

>Glyma02g16750.1   sequence type=predicted peptide   gene model=Glyma02g16750   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTISLFMCRVTQPIINVPCSGKKLIVRQIEKEKVVVVMGATGAGKSRLSIDLATCFPSEIINADKIQVFEGLDIVTNKISKEEQRGVPHHLLGTIKPNMDFSVNDFCDTSSEAIDSITRCQKLPIVVGGSNSYLEALMDDDDYKFRSRYDILCLWVDVEMSVLKSYVADRVDHMFYKGMVDELRPFYSPNGDYSRGVKRAIGVPEFHEYFGREEVADEETKQRLLEQAVKEIKLNTCKLAMKQLGKIRRLRNVKRWHIHRLDATPVFRMRGEEANDAWKRLVAKPSALIVARFLYNNNSKNNANVVSGSGLRVQPAASESVLAAATC*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo