SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g16150

Feature Type:gene_model
Chromosome:Gm02
Start:14567489
stop:14569278
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma02g16150
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G54560AT Annotation by Michelle Graham. TAIR10: histone H2A 11 | chr3:20196532-20197466 FORWARD LENGTH=136 SoyBaseE_val: 7.00E-79ISS
GO:0006338GO-bp Annotation by Michelle Graham. GO Biological Process: chromatin remodeling SoyBaseN/AISS
GO:0009908GO-bp Annotation by Michelle Graham. GO Biological Process: flower development SoyBaseN/AISS
GO:0009909GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of flower development SoyBaseN/AISS
GO:0010468GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of gene expression SoyBaseN/AISS
GO:0016048GO-bp Annotation by Michelle Graham. GO Biological Process: detection of temperature stimulus SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0044030GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of DNA methylation SoyBaseN/AISS
GO:0000786GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleosome SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
KOG1757 KOG Histone 2A JGI ISS
PTHR23430Panther HISTONE H2A JGI ISS
PF00125PFAM Core histone H2A/H2B/H3/H4 JGI ISS
UniRef100_C6SYX2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Histone H2A n=1 Tax=Glycine max RepID=C6SYX2_SOYBN SoyBaseE_val: 9.00E-91ISS
UniRef100_C6SYX2UniRef Annotation by Michelle Graham. Best UniRef hit: Histone H2A n=1 Tax=Glycine max RepID=C6SYX2_SOYBN SoyBaseE_val: 9.00E-91ISS

Proteins Associated with Glyma02g16150
LocusGene SymbolProtein Name
HTA8 HISTONE H2A 8

Expression Patterns of Glyma02g16150
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma02g16150
ParalogEvidenceComments
Glyma10g03640 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma02g16150 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g143200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma02g16150
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma02g16150
>Glyma02g16150.1   sequence type=CDS   gene model=Glyma02g16150   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGGGAAAAGGAGGGAAGGGGCTTCTTGCAGCGAAAACCACCGCGGCGAATAAGGACAAAGACAAGGACAAGAAGAGACCTATTTCTCGCTCTTCCCGTGCTGGAATCCAGTTTCCTGTGGGACGTATCCATAGGCAGCTGAAACAAAGGGTCCAAGCCAATGGACGTGTTGGGGCAACAGCTGCAGTGTACTTAGCCTCAATTCTAGAGTATCTGACTGCTGAAGTTCTTGAACTTGCTGGGAATGCAAGCAAGGATCTGAAGGTGAAGAGGATCACACCAAGGCATTTGCAGCTGGCTATCAGGGGAGATGAGGAGCTGGACACTCTTATCAAAGGGACCATTGCTGGTGGTGGTGTCATTCCTCACATTCACAAGTCCTTGATCAACAAAACCGCCAAGGATTGA
Predicted protein sequences of Glyma02g16150
>Glyma02g16150.1   sequence type=predicted peptide   gene model=Glyma02g16150   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAGKGGKGLLAAKTTAANKDKDKDKKRPISRSSRAGIQFPVGRIHRQLKQRVQANGRVGATAAVYLASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKTAKD*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo