Glyma02g15910 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g15910

Feature Type:	gene_model
Chromosome:	Gm02
Start:	14372159
stop:	14373784
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma02g15910

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G30620	AT	Annotation by Michelle Graham. TAIR10: winged-helix DNA-binding transcription factor family protein \| chr2:13045360-13046267 FORWARD LENGTH=273	SoyBase	E_val: 1.00E-45	ISS
GO:0006334	GO-bp	Annotation by Michelle Graham. GO Biological Process: nucleosome assembly	SoyBase	N/A	ISS
GO:0000786	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleosome	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005730	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleolus	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
PTHR11467	Panther	HISTONE H1/H5	JGI		ISS
PF00538	PFAM	linker histone H1 and H5 family	JGI		ISS
UniRef100_G8YZP6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Histone H1 subtype 3 n=1 Tax=Pisum sativum subsp. sativum RepID=G8YZP6_PEA	SoyBase	E_val: 5.00E-44	ISS
UniRef100_I1JF32	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JF32_SOYBN	SoyBase	E_val: 4.00E-161	ISS

Expression Patterns of Glyma02g15910

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma02g15910

Paralog	Evidence	Comments
Glyma10g03840	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma02g15910 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.02g140900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma02g15910

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma02g15910

Limit To All Plant Sequences

>Glyma02g15910.2   sequence type=CDS   gene model=Glyma02g15910   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCTCAGAAGAGCCCACTGTCGCGGTGGAACCCGCTCCCGAACCTGCCACCGCCGAGCCTCCCCCGGAGGAGAAGGAGGAGCCCAAACCTGAAGCCAAGGCTAAGAAAACCAAGGAACCCAAACCTAAAAAGGTTTCCAGACCACGCAACCCTCCCACTCATCCTTCCTACGAGGAGATGATTAAAGACGCAATTACCTCGCTGAAGGAGAAAACCGGTTCGAGCCAACACGCGATTGCGAAGTTCATCGAGGAGAAGCACAAGCAGCTTCCACCGAACTTCAGGAAGCTTCTTCTCTACCATTTGAAGAAACTTGTAGCCGCTGGAAAACTCGTCAAAGTCAAAGGCTCCTTCAAGCTCCCACCTACCCGACCTTCTGCATCTTCTTCTTCTTCGCCGGCGAAGAAGAAGAAGCCCGCACCTGCTAAGCCCCAACCCAAGCCCAAGCCTAAGCCTAAGCCCAAGCCCGCTGCTGCTGCTGCTGCTTCCAAGCCCAAGCCTGCTGCCGCCAAGCCCAAAGGGACTAAGCCAGCTGCCAAGCCCAAGCCCAAGCCCGCTGCTAAAACAAAGGCTGCTGCTGCCAAGCCCGCGGCAAAGCCCAAAGCGAAGCCCGCCAAGGCTTCAAGGACGTCGACACGGACTTCACCAGGGAAGAAAGCAGCTCCTGCTGCGAAGCCGGCAGCGAAGAAAGTAGCGCCTGCTAAGAAAGCGCCAGTGAAGAGTGTGAAACCAAAGAGTGTAAAGTCTCCAGCGAAAAAGGCTACGGCTAAGAGAGGGGGTAGGAAGTGA

Predicted protein sequences of Glyma02g15910

Limit To All Plant Sequences

>Glyma02g15910.2   sequence type=predicted peptide   gene model=Glyma02g15910   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASEEPTVAVEPAPEPATAEPPPEEKEEPKPEAKAKKTKEPKPKKVSRPRNPPTHPSYEEMIKDAITSLKEKTGSSQHAIAKFIEEKHKQLPPNFRKLLLYHLKKLVAAGKLVKVKGSFKLPPTRPSASSSSSPAKKKKPAPAKPQPKPKPKPKPKPAAAAAASKPKPAAAKPKGTKPAAKPKPKPAAKTKAAAAKPAAKPKAKPAKASRTSTRTSPGKKAAPAAKPAAKKVAPAKKAPVKSVKPKSVKSPAKKATAKRGGRK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain