SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Notice: fwrite(): Write of 157 bytes failed with errno=28 No space left on device in /var/www/html/include/SeqFeatClass.php on line 369

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g15910): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g15910): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g15910

Feature Type:gene_model
Chromosome:Gm02
Start:14372159
stop:14373784
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G30620AT Annotation by Michelle Graham. TAIR10: winged-helix DNA-binding transcription factor family protein | chr2:13045360-13046267 FORWARD LENGTH=273 SoyBaseE_val: 1.00E-45ISS
GO:0006334GO-bp Annotation by Michelle Graham. GO Biological Process: nucleosome assembly SoyBaseN/AISS
GO:0000786GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleosome SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005730GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleolus SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
PTHR11467Panther HISTONE H1/H5 JGI ISS
PF00538PFAM linker histone H1 and H5 family JGI ISS
UniRef100_G8YZP6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Histone H1 subtype 3 n=1 Tax=Pisum sativum subsp. sativum RepID=G8YZP6_PEA SoyBaseE_val: 5.00E-44ISS
UniRef100_I1JF32UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JF32_SOYBN SoyBaseE_val: 4.00E-161ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g15910 not represented in the dataset

Glyma02g15910 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma10g03840 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g140900 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma02g15910.2   sequence type=CDS   gene model=Glyma02g15910   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCTCAGAAGAGCCCACTGTCGCGGTGGAACCCGCTCCCGAACCTGCCACCGCCGAGCCTCCCCCGGAGGAGAAGGAGGAGCCCAAACCTGAAGCCAAGGCTAAGAAAACCAAGGAACCCAAACCTAAAAAGGTTTCCAGACCACGCAACCCTCCCACTCATCCTTCCTACGAGGAGATGATTAAAGACGCAATTACCTCGCTGAAGGAGAAAACCGGTTCGAGCCAACACGCGATTGCGAAGTTCATCGAGGAGAAGCACAAGCAGCTTCCACCGAACTTCAGGAAGCTTCTTCTCTACCATTTGAAGAAACTTGTAGCCGCTGGAAAACTCGTCAAAGTCAAAGGCTCCTTCAAGCTCCCACCTACCCGACCTTCTGCATCTTCTTCTTCTTCGCCGGCGAAGAAGAAGAAGCCCGCACCTGCTAAGCCCCAACCCAAGCCCAAGCCTAAGCCTAAGCCCAAGCCCGCTGCTGCTGCTGCTGCTTCCAAGCCCAAGCCTGCTGCCGCCAAGCCCAAAGGGACTAAGCCAGCTGCCAAGCCCAAGCCCAAGCCCGCTGCTAAAACAAAGGCTGCTGCTGCCAAGCCCGCGGCAAAGCCCAAAGCGAAGCCCGCCAAGGCTTCAAGGACGTCGACACGGACTTCACCAGGGAAGAAAGCAGCTCCTGCTGCGAAGCCGGCAGCGAAGAAAGTAGCGCCTGCTAAGAAAGCGCCAGTGAAGAGTGTGAAACCAAAGAGTGTAAAGTCTCCAGCGAAAAAGGCTACGGCTAAGAGAGGGGGTAGGAAGTGA

>Glyma02g15910.2   sequence type=predicted peptide   gene model=Glyma02g15910   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASEEPTVAVEPAPEPATAEPPPEEKEEPKPEAKAKKTKEPKPKKVSRPRNPPTHPSYEEMIKDAITSLKEKTGSSQHAIAKFIEEKHKQLPPNFRKLLLYHLKKLVAAGKLVKVKGSFKLPPTRPSASSSSSPAKKKKPAPAKPQPKPKPKPKPKPAAAAAASKPKPAAAKPKGTKPAAKPKPKPAAKTKAAAAKPAAKPKAKPAKASRTSTRTSPGKKAAPAAKPAAKKVAPAKKAPVKSVKPKSVKSPAKKATAKRGGRK*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo