SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g15260

Feature Type:gene_model
Chromosome:Gm02
Start:13777707
stop:13779498
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma02g15260
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G26520AT Annotation by Michelle Graham. TAIR10: unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT3G57500.1); Has 51 Blast hits to 51 proteins in 11 species: Archae - 0; Bacteria - 1; Metazoa - 0; Fungi - 0; Plants - 50; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr2:11280280-11280717 FORWARD LENGTH=145 SoyBaseE_val: 1.00E-21ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_I1JEX1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JEX1_SOYBN SoyBaseE_val: 1.00E-86ISS
UniRef100_O48719UniRef Annotation by Michelle Graham. Most informative UniRef hit: Expressed protein n=1 Tax=Arabidopsis thaliana RepID=O48719_ARATH SoyBaseE_val: 7.00E-19ISS

Expression Patterns of Glyma02g15260
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma02g15260
ParalogEvidenceComments
Glyma07g33190 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma02g15260 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g134900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma02g15260
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma02g15260
>Glyma02g15260.1   sequence type=CDS   gene model=Glyma02g15260   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCCACACCATTTGTTCAACAGCCACCACCCATAGAAGTGACCCAACAAGCCTACACGACCCATTCGGGTCACGGGTCGGTGGGACCCGTCATAGCGGTCCTCGCCGTCATCACCGTTCTCGGCGTCATCGCCGGCATGATCGGTAGGCTCTGTTCGGGTCGTCGGGTCATGGGTCACGGCGAGTTTGACGTCGAAACCTGGGTCGAAACCAAATGCTCCTCCTGCGTCGACGGCAGAATCGCCCCTCCGCCGCCACGACCACGTCCTCCGCCACCGCCGGAACACAACTCCGGCGAGGAATCGCCACCGGAGGAACCCCCTCAAGAGATCAAAGAACAACAACAACAGCGAGAAGAAGAGCAACACTCACATTCCCCCAGTAATAGTTAA
Predicted protein sequences of Glyma02g15260
>Glyma02g15260.1   sequence type=predicted peptide   gene model=Glyma02g15260   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSTPFVQQPPPIEVTQQAYTTHSGHGSVGPVIAVLAVITVLGVIAGMIGRLCSGRRVMGHGEFDVETWVETKCSSCVDGRIAPPPPRPRPPPPPEHNSGEESPPEEPPQEIKEQQQQREEEQHSHSPSNS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo