SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g14990

Feature Type:gene_model
Chromosome:Gm02
Start:13559658
stop:13564151
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma02g14990
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G19220AT Annotation by Michelle Graham. TAIR10: protein disulfide isomerases | chr3:6659207-6660488 FORWARD LENGTH=187 SoyBaseE_val: 7.00E-59ISS
GO:0009658GO-bp Annotation by Michelle Graham. GO Biological Process: chloroplast organization SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009535GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane SoyBaseN/AISS
GO:0003756GO-mf Annotation by Michelle Graham. GO Molecular Function: protein disulfide isomerase activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0043621GO-mf Annotation by Michelle Graham. GO Molecular Function: protein self-association SoyBaseN/AISS
UniRef100_G7JL97UniRef Annotation by Michelle Graham. Most informative UniRef hit: Calmodulin-like protein n=2 Tax=Medicago truncatula RepID=G7JL97_MEDTR SoyBaseE_val: 1.00E-56ISS
UniRef100_I1JEU6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JEU6_SOYBN SoyBaseE_val: 8.00E-132ISS

Expression Patterns of Glyma02g14990
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma02g14990
ParalogEvidenceComments
Glyma07g33470 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma02g14990 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g132900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma02g14990
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma02g14990
>Glyma02g14990.1   sequence type=CDS   gene model=Glyma02g14990   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCGAATGTTCGCTACCAATGCCACGAGCAACCTCTTCTTCCCCTGCAGCCCTTCGTCCTTCCGGTGCCGCGCCGCCGCCGGAGACCTCTCCGCGGGCCCCTCCTTCATCCAGTCCGTCGCCGGCGGTCTAAGAATTGGCCAGTTCCCCGACGGCGCAGGACTCGCCGTGGAAGGACGGCGCGGCGGCGGCGGAAACGAACCAATAAGGGTGAAGAAATGGTCTCGGAAGAATGAGAGTTACTTGGATAACGACGCCGAGCCTCTTCCCCTTCCAATGACGTATCCCGATTCCTCGCCCGTTTCGCAAGAAGAGATTGATAAGCGCCTCCAATGCGATCCCCAAATTCAGGATTGTAAAGAGGTGGTGTATGAATGGACTGGGAAGTGCCGTAGTTGCCAAGGATCGGGATATGTGAGCTACTATGGCAAGAGAGGGAAACCGGTTACCTGCAAATGCATTCCTTGCATGGGAATTGGTTACGTGCAGAAGATAACAGCTCGCAAGGATATTGATGTAATGGAGGATTTGGAGAATGGAAAACCACCATGA
Predicted protein sequences of Glyma02g14990
>Glyma02g14990.1   sequence type=predicted peptide   gene model=Glyma02g14990   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MRMFATNATSNLFFPCSPSSFRCRAAAGDLSAGPSFIQSVAGGLRIGQFPDGAGLAVEGRRGGGGNEPIRVKKWSRKNESYLDNDAEPLPLPMTYPDSSPVSQEEIDKRLQCDPQIQDCKEVVYEWTGKCRSCQGSGYVSYYGKRGKPVTCKCIPCMGIGYVQKITARKDIDVMEDLENGKPP*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo