Glyma02g14940 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g14940

Feature Type:	gene_model
Chromosome:	Gm02
Start:	13534865
stop:	13536087
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma02g14940

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G34410	AT	Annotation by Michelle Graham. TAIR10: redox responsive transcription factor 1 \| chr4:16451992-16452798 FORWARD LENGTH=268	SoyBase	E_val: 1.00E-28	ISS
GO:0002679	GO-bp	Annotation by Michelle Graham. GO Biological Process: respiratory burst involved in defense response	SoyBase	N/A	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0009693	GO-bp	Annotation by Michelle Graham. GO Biological Process: ethylene biosynthetic process	SoyBase	N/A	ISS
GO:0010200	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to chitin	SoyBase	N/A	ISS
GO:0035556	GO-bp	Annotation by Michelle Graham. GO Biological Process: intracellular signal transduction	SoyBase	N/A	ISS
GO:0050832	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response to fungus	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
PF00847	PFAM	AP2 domain	JGI		ISS
UniRef100_B3IX34	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Transcription factor AP2-EREBP n=1 Tax=Lotus japonicus RepID=B3IX34_LOTJA	SoyBase	E_val: 7.00E-71	ISS
UniRef100_I1JEU3	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JEU3_SOYBN	SoyBase	E_val: 4.00E-158	ISS

Expression Patterns of Glyma02g14940

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma02g14940

Paralog	Evidence	Comments
Glyma07g33511	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma02g14940 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.02g132500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma02g14940

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma02g14940

Limit To All Plant Sequences

>Glyma02g14940.1   sequence type=CDS   gene model=Glyma02g14940   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCCTCTTCCTCTTCCTCCTTCTTCCCCGCCCATATCACCACCGACCAAGAATTCTCCCTCATCGTTGCCGCCCTCACCAACGTCGTCTCCGGCTCTACCTCCAGCTCCTCCGTCCCTGAATTCCGCTTCCCGCACTCCTCCCCGCCTCTTTCTGCCGCCAGCCTTATGCCGCCACCCCTGCCTAGCATCCACACGTGTCGCGAGTGCAACATCGCAGGATGCCTGGGATGCAACTTTTTCCCCGAGGAACAAAGGAAGAAATACAGAGGAGTTAGGCAGAGGCCTTCGGGAAAGTGGGCCGCCGAGATTCGCGATCGTCATCGTTCGGCCCGGGTCTGGCTCGGTACATTCGAAACCGCCGAGGACGCCGCCCGGGCCTATGACAAGGCCTCGTTCGAGTTACGCGGCCCACGGGCCAAGCTCAATTTCCCCTTGGTCGACGAGTCGCTCACTCTCCAGCCGGAGATGGCTGCAACAGAAGAGCAGATTAACAACGAGGATAATCTCAATCAAGGCATGGGAATGGACTCGCACGAATTCTGGGACAGGATCAACGAAGCTGATTTTCATCCGTTCATGATGATGATGGATTTTACTGGAGATTCTTCAGACTCTGCTGCCACTGGGTACACTCTCAGTTCCTGA

Predicted protein sequences of Glyma02g14940

Limit To All Plant Sequences

>Glyma02g14940.1   sequence type=predicted peptide   gene model=Glyma02g14940   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSSSSSSFFPAHITTDQEFSLIVAALTNVVSGSTSSSSVPEFRFPHSSPPLSAASLMPPPLPSIHTCRECNIAGCLGCNFFPEEQRKKYRGVRQRPSGKWAAEIRDRHRSARVWLGTFETAEDAARAYDKASFELRGPRAKLNFPLVDESLTLQPEMAATEEQINNEDNLNQGMGMDSHEFWDRINEADFHPFMMMMDFTGDSSDSAATGYTLSS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain