SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g14930

Feature Type:gene_model
Chromosome:Gm02
Start:13518961
stop:13524569
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma02g14930
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G19260AT Annotation by Michelle Graham. TAIR10: LAG1 homologue 2 | chr3:6669448-6671257 REVERSE LENGTH=296 SoyBaseE_val: 7.00E-134ISS
GO:0002238GO-bp Annotation by Michelle Graham. GO Biological Process: response to molecule of fungal origin SoyBaseN/AISS
GO:0016126GO-bp Annotation by Michelle Graham. GO Biological Process: sterol biosynthetic process SoyBaseN/AISS
GO:0042759GO-bp Annotation by Michelle Graham. GO Biological Process: long-chain fatty acid biosynthetic process SoyBaseN/AISS
GO:0046520GO-bp Annotation by Michelle Graham. GO Biological Process: sphingoid biosynthetic process SoyBaseN/AISS
GO:0005783GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0016021GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane SoyBaseN/AISS
GO:0050291GO-mf Annotation by Michelle Graham. GO Molecular Function: sphingosine N-acyltransferase activity SoyBaseN/AISS
KOG1607 KOG Protein transporter of the TRAM (translocating chain-associating membrane) superfamily JGI ISS
PTHR12560Panther LONGEVITY ASSURANCE FACTOR 1 (LAG1) JGI ISS
PF03798PFAM TLC domain JGI ISS
UniRef100_G7JL86UniRef Annotation by Michelle Graham. Most informative UniRef hit: LAG1 longevity assurance-like protein n=1 Tax=Medicago truncatula RepID=G7JL86_MEDTR SoyBaseE_val: 9.00E-169ISS
UniRef100_UPI0002336B1DUniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002336B1D related cluster n=1 Tax=unknown RepID=UPI0002336B1D SoyBaseE_val: 0ISS

Expression Patterns of Glyma02g14930
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma02g14930
ParalogEvidenceComments
Glyma07g33530 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma02g14930 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g132400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma02g14930
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma02g14930
>Glyma02g14930.3   sequence type=CDS   gene model=Glyma02g14930   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATTTCCTCTGGAGCGAGAATGCGGCGACGCCGCGCGCCTCGCATTTCTCCGTTGCGATCTACTTCGCCTTCGCCAGTTTCGCGGCCAGGTTCTTCCTTGACAGATTCGTCTTTCGCAGGTTGGCCATTAGGATTTTGACGAAGGGTAGAGCTCCTTTACATATTACTAAGGAAATGCAAGTAAAGATTGGAAAATGCTCAGAATCAATGTGGAAGCTAACATATTATGCTACAGTTGAAGCATTCATTCTTAAAATTACCTACCAAGAACCCTGGTTCAGTAACACGAAATTATACTTCAATGACTGGCCAAATCATGAGTTGAAGAGTCCCCTAGTGTTGTACTACATGTGCCAGTGTGGGTTCTACATATATAGCATTGCTGCTATTCTTACATGGGAGACTCGAAGGAAGGATTTTGCAGTGATGTTTACTCACCATGTAATTACTGTTTTACTGATTGGGATTTCATATCTAACAAGTTTTTTTAGGGTTGGCTCCATAATTCTCGCCCTTCATGATGCAAGTGACGTATTCATGGAAGCTGCCAAGGTTTTCAAGTATTCTGGAAGGGAGTTTGGTGCAAGTGTGTGTTTTGGATTCTTTGCAGTTTCGTGGCTCATACTGCGGCTAATTTTCTTTCCTTTTTGGGTTATTAAAGCAACAAGCATTGATCTTCAGCAGGTCTTAAACCTGTCAGAGGGCTTTCATATGTTTCTTTACTATGTTTTTAATACAATGCTCATAATGCTGCTCATCTTCCATATATACTGGTGGAAGCTCATTTGTGCGATGATCTTGAGGCAACTTAAAAATAGGGGAAAAGTTGGCGAGGATATAAGATCAGATTCTGACGATGATTGA
Predicted protein sequences of Glyma02g14930
>Glyma02g14930.3   sequence type=predicted peptide   gene model=Glyma02g14930   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDFLWSENAATPRASHFSVAIYFAFASFAARFFLDRFVFRRLAIRILTKGRAPLHITKEMQVKIGKCSESMWKLTYYATVEAFILKITYQEPWFSNTKLYFNDWPNHELKSPLVLYYMCQCGFYIYSIAAILTWETRRKDFAVMFTHHVITVLLIGISYLTSFFRVGSIILALHDASDVFMEAAKVFKYSGREFGASVCFGFFAVSWLILRLIFFPFWVIKATSIDLQQVLNLSEGFHMFLYYVFNTMLIMLLIFHIYWWKLICAMILRQLKNRGKVGEDIRSDSDDD*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo