SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g14800): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g14800): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g14800

Feature Type:gene_model
Chromosome:Gm02
Start:13325174
stop:13326401
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma02g14800
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G68760AT Annotation by Michelle Graham. TAIR10: nudix hydrolase 1 | chr1:25829090-25829607 FORWARD LENGTH=147 SoyBaseE_val: 5.00E-32ISS
GO:0006974GO-bp Annotation by Michelle Graham. GO Biological Process: response to DNA damage stimulus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0008413GO-mf Annotation by Michelle Graham. GO Molecular Function: 8-oxo-7,8-dihydroguanosine triphosphate pyrophosphatase activity SoyBaseN/AISS
GO:0016787GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity SoyBaseN/AISS
GO:0019177GO-mf Annotation by Michelle Graham. GO Molecular Function: dihydroneopterin triphosphate pyrophosphohydrolase activity SoyBaseN/AISS
PF00293PFAM NUDIX domain JGI ISS
UniRef100_G7KA76UniRef Annotation by Michelle Graham. Most informative UniRef hit: Nudix hydrolase n=1 Tax=Medicago truncatula RepID=G7KA76_MEDTR SoyBaseE_val: 5.00E-32ISS
UniRef100_UPI0002336B19UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002336B19 related cluster n=1 Tax=unknown RepID=UPI0002336B19 SoyBaseE_val: 2.00E-73ISS

Expression Patterns of Glyma02g14800
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g14800 not represented in the dataset
Glyma02g14800 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g14800 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g131100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma02g14800
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma02g14800
>Glyma02g14800.2   sequence type=CDS   gene model=Glyma02g14800   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTGGTGGTTATCATTTTCCTCTTGAAGATAGATCGGTCCTCCTCAGTCGTTGCCGCTATGCCGTCGGCAATGCCACCTTCGCCCTTCAAGGCGGCGGTCACCTTGAATTCGGGGAGAGTTTTGAGGAATGTGCAGCAAGAGAAGTGAAAGAGGAAACAGGGTTGGACATAGGAAACTCATTGAAAGAGCAAGTGCCACAAAATCTTGAACCTACCAAGTGTGATGATTGGGATTGGTATGAGTGGGATCATTTGTCACACCCTCTGTTTGGGCCTCTTGAGAAAATGGTTAAAGGAGCTTTCGACCCATTTCTAATTTGA
Predicted protein sequences of Glyma02g14800
>Glyma02g14800.2   sequence type=predicted peptide   gene model=Glyma02g14800   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGGGYHFPLEDRSVLLSRCRYAVGNATFALQGGGHLEFGESFEECAAREVKEETGLDIGNSLKEQVPQNLEPTKCDDWDWYEWDHLSHPLFGPLEKMVKGAFDPFLI*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo