SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g14061): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g14061): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g14061

Feature Type:gene_model
Chromosome:Gm02
Start:12437658
stop:12446430
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma02g14061
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G13580AT Annotation by Michelle Graham. TAIR10: LAG1 longevity assurance homolog 3 | chr1:4645006-4646765 REVERSE LENGTH=308 SoyBaseE_val: 6.00E-71ISS
GO:0006499GO-bp Annotation by Michelle Graham. GO Biological Process: N-terminal protein myristoylation SoyBaseN/AISS
GO:0016126GO-bp Annotation by Michelle Graham. GO Biological Process: sterol biosynthetic process SoyBaseN/AISS
GO:0042761GO-bp Annotation by Michelle Graham. GO Biological Process: very long-chain fatty acid biosynthetic process SoyBaseN/AISS
GO:0046520GO-bp Annotation by Michelle Graham. GO Biological Process: sphingoid biosynthetic process SoyBaseN/AISS
GO:0005783GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum SoyBaseN/AISS
GO:0016021GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane SoyBaseN/AISS
GO:0050291GO-mf Annotation by Michelle Graham. GO Molecular Function: sphingosine N-acyltransferase activity SoyBaseN/AISS
PTHR12560Panther LONGEVITY ASSURANCE FACTOR 1 (LAG1) JGI ISS
PF03798PFAM TLC domain JGI ISS
UniRef100_B9TAI2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Longevity assurance factor, putative n=1 Tax=Ricinus communis RepID=B9TAI2_RICCO SoyBaseE_val: 6.00E-71ISS
UniRef100_I1JEN4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JEN4_SOYBN SoyBaseE_val: 2.00E-99ISS

Expression Patterns of Glyma02g14061
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g14061 not represented in the dataset
Glyma02g14061 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g14061 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma02g14061
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma02g14061
>Glyma02g14061.1   sequence type=CDS   gene model=Glyma02g14061   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGCCATCATGTTATTACTGTCATTCTCATCGTGTTATCCTACATTTTTAGGTTTGTTCGTGTTGGATCTGTAGTTTTAGCTCTTCATGATGCTAGTGATGTGTTTATCGAGACAGGGAAAATGTCCAAATACAGTGGTGCTGAAACAACAGCTAGCATTGCATTTATTCTTTTTGTTTTGTGTTTTACCGTGACGCGGATCATTTACTACCCATTCTGGATTCTTAGGAGTACGAGCTATGAAGTTGTTCACGCCTTGAAAATGGACCTGGTGGATGGTCCATTATATTATTATGTGTTCAATGCTCTTCTATATTTCTTGCTAGTTCTTCATATATATTGGTGGGTTCTGATGCTTAGGATGCTTGTTAAACAAATCCAAGAAAAAGGAAAAGTTAGTGAAGATATACGATCTGATTCAGAAGATGAACATGAACATAAACATGAAGAATGA
Predicted protein sequences of Glyma02g14061
>Glyma02g14061.1   sequence type=predicted peptide   gene model=Glyma02g14061   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGHHVITVILIVLSYIFRFVRVGSVVLALHDASDVFIETGKMSKYSGAETTASIAFILFVLCFTVTRIIYYPFWILRSTSYEVVHALKMDLVDGPLYYYVFNALLYFLLVLHIYWWVLMLRMLVKQIQEKGKVSEDIRSDSEDEHEHKHEE*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo