SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g13350

Feature Type:gene_model
Chromosome:Gm02
Start:11646845
stop:11649188
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma02g13350
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G69180AT Annotation by Michelle Graham. TAIR10: Plant-specific transcription factor YABBY family protein | chr1:26007734-26008940 REVERSE LENGTH=181 SoyBaseE_val: 5.00E-65ISS
GO:0006333GO-bp Annotation by Michelle Graham. GO Biological Process: chromatin assembly or disassembly SoyBaseN/AISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009827GO-bp Annotation by Michelle Graham. GO Biological Process: plant-type cell wall modification SoyBaseN/AISS
GO:0009860GO-bp Annotation by Michelle Graham. GO Biological Process: pollen tube growth SoyBaseN/AISS
GO:0009886GO-bp Annotation by Michelle Graham. GO Biological Process: post-embryonic morphogenesis SoyBaseN/AISS
GO:0009909GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of flower development SoyBaseN/AISS
GO:0009944GO-bp Annotation by Michelle Graham. GO Biological Process: polarity specification of adaxial/abaxial axis SoyBaseN/AISS
GO:0010093GO-bp Annotation by Michelle Graham. GO Biological Process: specification of floral organ identity SoyBaseN/AISS
GO:0010254GO-bp Annotation by Michelle Graham. GO Biological Process: nectary development SoyBaseN/AISS
GO:0010582GO-bp Annotation by Michelle Graham. GO Biological Process: floral meristem determinacy SoyBaseN/AISS
GO:0031540GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of anthocyanin biosynthetic process SoyBaseN/AISS
GO:0048440GO-bp Annotation by Michelle Graham. GO Biological Process: carpel development SoyBaseN/AISS
GO:0048441GO-bp Annotation by Michelle Graham. GO Biological Process: petal development SoyBaseN/AISS
GO:0048443GO-bp Annotation by Michelle Graham. GO Biological Process: stamen development SoyBaseN/AISS
GO:0048479GO-bp Annotation by Michelle Graham. GO Biological Process: style development SoyBaseN/AISS
GO:0048481GO-bp Annotation by Michelle Graham. GO Biological Process: ovule development SoyBaseN/AISS
GO:0048507GO-bp Annotation by Michelle Graham. GO Biological Process: meristem development SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
PF04690PFAM YABBY protein JGI ISS
UniRef100_G7JWX9UniRef Annotation by Michelle Graham. Most informative UniRef hit: CRABS CLAW n=1 Tax=Medicago truncatula RepID=G7JWX9_MEDTR SoyBaseE_val: 3.00E-89ISS
UniRef100_UPI0002337A8DUniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002337A8D related cluster n=1 Tax=unknown RepID=UPI0002337A8D SoyBaseE_val: 9.00E-124ISS

Expression Patterns of Glyma02g13350
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma02g13350
ParalogEvidenceComments
Glyma01g08030 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma02g13350 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g121100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma02g13350
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma02g13350
>Glyma02g13350.2   sequence type=CDS   gene model=Glyma02g13350   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAACCACGAAGACAAACTCACCATGGACCTGGTTCCACCATCTGAACACCTCTGCTACGTTCGTTGCAACTTCTGCAACACTGTCCTCGCGGTTGGTATCCCATGCAAGAGGCTGTTAGACACTGTGACAGTGAAGTGTGGTCACTGCAGCAACCTCTCCTTTCTGAGCACCAGACCCCCAAGTTCTCAAAGCCAAAGCGTTGATCACACCCTCAGTCTGCAGGGGTTTTACAGTAATGCCAAAAAGGGACAAGCATCATCTTCATCTTCCTCACCAACAACATCTAACGAGTCAGTGTCCCCAAAAGCAGCATCATTTGTTGTGAAACCACCTGAGAAAAAGCACCGTCTCCCTTCTGCTTACAACCGTTTCATGAAAGAGGAGATACAGCGCATCAAAGCTGCGAACCCTGAGATCCCACATCGAGAAGCTTTCAGTGCTGCAGCGAAAAATTGGGCTAGGTTCATTCCAAATTCACCAACCAGTTCAGTTTCTGCAACTAAAGTTAATGCTGATTGA
Predicted protein sequences of Glyma02g13350
>Glyma02g13350.2   sequence type=predicted peptide   gene model=Glyma02g13350   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNHEDKLTMDLVPPSEHLCYVRCNFCNTVLAVGIPCKRLLDTVTVKCGHCSNLSFLSTRPPSSQSQSVDHTLSLQGFYSNAKKGQASSSSSSPTTSNESVSPKAASFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARFIPNSPTSSVSATKVNAD*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo