Glyma02g13053 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g13053): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g13053): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g13053

Feature Type:	gene_model
Chromosome:	Gm02
Start:	11302120
stop:	11303308
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma02g13053

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G05530	AT	Annotation by Michelle Graham. TAIR10: indole-3-butyric acid response 1 \| chr4:2816462-2818074 FORWARD LENGTH=254	SoyBase	E_val: 7.00E-33	ISS
GO:0008152	GO-bp	Annotation by Michelle Graham. GO Biological Process: metabolic process	SoyBase	N/A	ISS
GO:0048767	GO-bp	Annotation by Michelle Graham. GO Biological Process: root hair elongation	SoyBase	N/A	ISS
GO:0080024	GO-bp	Annotation by Michelle Graham. GO Biological Process: indolebutyric acid metabolic process	SoyBase	N/A	ISS
GO:0080026	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to indolebutyric acid stimulus	SoyBase	N/A	ISS
GO:0005777	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: peroxisome	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0000166	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleotide binding	SoyBase	N/A	ISS
GO:0016491	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity	SoyBase	N/A	ISS
PTHR24322	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR24322:SF67	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF00106	PFAM	short chain dehydrogenase	JGI		ISS
UniRef100_B0M195	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Peroxisomal short-chain dehydrogenase/reductase family protein n=1 Tax=Glycine max RepID=B0M195_SOYBN	SoyBase	E_val: 1.00E-39	ISS
UniRef100_C6T421	UniRef	Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6T421_SOYBN	SoyBase	E_val: 3.00E-72	ISS

Expression Patterns of Glyma02g13053

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g13053 not represented in the dataset	Glyma02g13053 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g13053 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.02g116900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma02g13053

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma02g13053

Limit To All Plant Sequences

>Glyma02g13053.1   sequence type=CDS   gene model=Glyma02g13053   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTCGTTTCTCAGACACAAATAAAGCCTCTTTCTTTATCTGAGTTGGGTAAGAGATTTGAAGGGAAAGTGGCAATTGTGACAGCTTCCACTCAGGGAATTGGCTTTGCCATAGCACATAGGCTTGGCTTGGAGGGTGCATCTGTTGTCATCTCTTCTCGCAAACAGCAAAATGTTGATGTGGCGGCTGAAAATCTCCGGGCTGAAGGAATTGAAGTGTTGGAAGTTGTTTGCCATGTTTCAAATGCTCAACAAAGGAAGAATTTGATAGACAAAACAGTTCAGGAGAGATTTATTCTGATAAGCTATGCAATTTATACCGACAGTGTATGA

Predicted protein sequences of Glyma02g13053

Limit To All Plant Sequences

>Glyma02g13053.1   sequence type=predicted peptide   gene model=Glyma02g13053   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVVSQTQIKPLSLSELGKRFEGKVAIVTASTQGIGFAIAHRLGLEGASVVISSRKQQNVDVAAENLRAEGIEVLEVVCHVSNAQQRKNLIDKTVQERFILISYAIYTDSV*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain