Report for Sequence Feature Glyma02g12930
Feature Type: gene_model
Chromosome: Gm02
Start: 11188826
stop: 11193147
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma02g12930
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G26480 AT
Annotation by Michelle Graham. TAIR10: general regulatory factor 12 | chr1:9156573-9157845 REVERSE LENGTH=268
SoyBase E_val: 5.00E-161 ISS
GO:0005737 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm
SoyBase N/A ISS
GO:0019904 GO-mf
Annotation by Michelle Graham. GO Molecular Function: protein domain specific binding
SoyBase N/A ISS
GO:0045309 GO-mf
Annotation by Michelle Graham. GO Molecular Function: protein phosphorylated amino acid binding
SoyBase N/A ISS
KOG0841
KOG
Multifunctional chaperone (14-3-3 family)
JGI ISS
PTHR18860 Panther
14-3-3
JGI ISS
PF00244 PFAM
14-3-3 protein
JGI ISS
UniRef100_E9KNA5 UniRef
Annotation by Michelle Graham. Best UniRef hit: SGF14f n=1 Tax=Glycine max RepID=E9KNA5_SOYBN
SoyBase E_val: 0 ISS
UniRef100_E9KNA5 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: SGF14f n=1 Tax=Glycine max RepID=E9KNA5_SOYBN
SoyBase E_val: 0 ISS
Expression Patterns of Glyma02g12930
Gene expression representations made with eFP at the University of Toronto. Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE Paralogs of Glyma02g12930
Paralog Evidence Comments
Glyma01g07070 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma02g12930 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.02g115900 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma02g12930
Coding sequences of Glyma02g12930
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma02g12930.1 sequence type=CDS gene model=Glyma02g12930 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGTCCGTCGAGAAAGAGAGAGAGACCCAGGTTTACTTGGCCAAGCTTGCCGAGCAGGCCGAGAGATACGAAGAAATGGTTGAGTGTATGAAGAAAGTAGCAAAACTTGATCTTGATCTGACTGTGGAAGAAAGGAACCTTCTCTCAGTGGGATACAAAAATGTGATTGGTGCACGAAGGGCCTCTTGGCGCATAATGTCCTCAATTGAGCAGAAGGAAGAGTCTAAGGGAAATGAGCACAATGTTAAACTGATCAAGAGTTACTGCCAAAAAGTTGAGGAGGAACTCTCCAAAATCTGTGGTGACATTCTGACTATTATAGACCAGCATTTGATTCCTTCTTCCGGATCAGCAGAAGCTAGCGTTTTCTACTACAAGATGAAAGGTGATTATTTTCGGTATCTTGCTGAGTTCAAGACTGACCAAGAAAGGAAAGAGGCAGCTGAGCAGTCACTAAAAGGATACGAGGCTGCTTCTGCCACTGCAAACACAGATCTTCCATCAACACATCCAATCCGTCTTGGACTTGCACTCAATTTCTCTGTCTTTTATTATGAGATAATGAACTCTCCTGAAAGGGCCTGCCATTTGGCCAAGCAAGCTTTTGATGAGGCAATTGCGGAGTTGGACACCCTGAGTGAAGAGTCATACAAGGACAGCACTTTGATCATGCAGCTGTTGAGAGACAACCTTACTCTCTGGACTTCCGATTTACCAGAGGATGGAGGTGAGGACAACATAAAAGCTGAAGAAGCCAAACCTTCTGAGCCTGAGCATTGA
Predicted protein sequences of Glyma02g12930
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma02g12930.1 sequence type=predicted peptide gene model=Glyma02g12930 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MSVEKERETQVYLAKLAEQAERYEEMVECMKKVAKLDLDLTVEERNLLSVGYKNVIGARRASWRIMSSIEQKEESKGNEHNVKLIKSYCQKVEEELSKICGDILTIIDQHLIPSSGSAEASVFYYKMKGDYFRYLAEFKTDQERKEAAEQSLKGYEAASATANTDLPSTHPIRLGLALNFSVFYYEIMNSPERACHLAKQAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDLPEDGGEDNIKAEEAKPSEPEH*
SoyBase
SoyBase transitions to NEW site on 10/1/2024
