|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G69370 | AT | Annotation by Michelle Graham. TAIR10: chorismate mutase 3 | chr1:26080098-26081559 FORWARD LENGTH=316 | SoyBase | E_val: 8.00E-43 | ISS |
| GO:0000162 | GO-bp | Annotation by Michelle Graham. GO Biological Process: tryptophan biosynthetic process | SoyBase | N/A | ISS |
| GO:0009073 | GO-bp | Annotation by Michelle Graham. GO Biological Process: aromatic amino acid family biosynthetic process | SoyBase | N/A | ISS |
| GO:0042742 | GO-bp | Annotation by Michelle Graham. GO Biological Process: defense response to bacterium | SoyBase | N/A | ISS |
| GO:0046417 | GO-bp | Annotation by Michelle Graham. GO Biological Process: chorismate metabolic process | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0009536 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plastid | SoyBase | N/A | ISS |
| GO:0004106 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: chorismate mutase activity | SoyBase | N/A | ISS |
| PTHR21145 | Panther | CHORISMATE MUTASE | JGI | ISS | |
| UniRef100_B9HXM7 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Chorismate mutase n=1 Tax=Populus trichocarpa RepID=B9HXM7_POPTR | SoyBase | E_val: 4.00E-42 | ISS |
| UniRef100_UPI0002337981 | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI0002337981 related cluster n=1 Tax=unknown RepID=UPI0002337981 | SoyBase | E_val: 9.00E-51 | ISS |
|
Glyma02g12586 not represented in the dataset |
Glyma02g12586 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma02g12586.1 sequence type=CDS gene model=Glyma02g12586 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGTTCTGCGCCACTCGGCTGATTCCATCAATATAAACAATAAGATTTGGAATATCTATTTTAAGGATATCCTCCCAAGATTGGTAAAAGCAGGAGATGATGATAACTGTGGATCTGTTACTGTTTGTGACACTCTTTGCTTGCAGGACAGGAAACTGTTGCTGGTGTTGTTGACATATGAAACAGTGGAGGAATTAGTCAAGAAGAGAGTAGAAATTAAGGCAAGAACATATGGCCAGCCAAGTTTGATTGCAGATCTTTATAGAGATTGGGTTATGCCTCTCACAAAAGAAGTGCAGGTGGAATACTTGTTGAGAAGACTTGACTAG
>Glyma02g12586.1 sequence type=predicted peptide gene model=Glyma02g12586 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MVLRHSADSININNKIWNIYFKDILPRLVKAGDDDNCGSVTVCDTLCLQDRKLLLVLLTYETVEELVKKRVEIKARTYGQPSLIADLYRDWVMPLTKEVQVEYLLRRLD*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||