SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g12540): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g12540): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g12540

Feature Type:gene_model
Chromosome:Gm02
Start:10827031
stop:10830128
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma02g12540
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G69390AT Annotation by Michelle Graham. TAIR10: homologue of bacterial MinE 1 | chr1:26084721-26086284 FORWARD LENGTH=229 SoyBaseE_val: 2.00E-91ISS
GO:0010020GO-bp Annotation by Michelle Graham. GO Biological Process: chloroplast fission SoyBaseN/AISS
GO:0032955GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of barrier septum assembly SoyBaseN/AISS
GO:0051301GO-bp Annotation by Michelle Graham. GO Biological Process: cell division SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009706GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast inner membrane SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0042802GO-mf Annotation by Michelle Graham. GO Molecular Function: identical protein binding SoyBaseN/AISS
GO:0051117GO-mf Annotation by Michelle Graham. GO Molecular Function: ATPase binding SoyBaseN/AISS
PF03776PFAM Septum formation topological specificity factor MinE JGI ISS
UniRef100_Q45RR9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Plastid division regulator MinE n=1 Tax=Glycine max RepID=Q45RR9_SOYBN SoyBaseE_val: 6.00E-170ISS
UniRef100_Q45RR9UniRef Annotation by Michelle Graham. Best UniRef hit: Plastid division regulator MinE n=1 Tax=Glycine max RepID=Q45RR9_SOYBN SoyBaseE_val: 6.00E-170ISS

Expression Patterns of Glyma02g12540
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g12540 not represented in the dataset
Glyma02g12540 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma02g12540
ParalogEvidenceComments
Glyma01g06620 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma02g12540 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g112600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma02g12540
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma02g12540
>Glyma02g12540.1   sequence type=CDS   gene model=Glyma02g12540   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGATTTCCGGCGATCTCAGAGTCTCAGCAACACTTCCTCTGTATCGCTCCCACTCGCCTCCACTCCGAACCTCTTCTCAGTCTTCCCCAAAGGTAGACTTTCATCGTTTCTTGAACAGAGCTTGTAGCATCTCTGAATTCACTCCAAAATGCCCTTACCTGACAATTGTACGATGCAATATGCGTGGGTATTGCAAGCCAGTTGCTGCGGTCCTTGGAGGTCCTAAATTTACATCAAATTCAGTTAGCCAAGAAACCGAGAACTTTCTCCTTGATGCTGTTAAAATGAACTTCTTTGAGCGGTTAAATTTGGCTTGGAAGATAATTTTCCCATCGGCAACATCTAGAAAAAACTCCAATGCTAGGATTGCTAAGCAACGCTTGAAGATGATTCTGTTCTCTGATCGGTGTGAAGTAAGTGATGAGGCAAAGCGAAAAATTGTTAGCAATGTTGTGCGTGCTCTATCAGATTTTGTGGAAATAGAATCACAGGATAAAGTTCAGCTGAGTGTCTCTGCTGATACAGATCTTGGAACTATTTACTCTGTCACAGTGCCTGTACGGCGGGTTAAACCAGAATATCAAGAAATGGATGAATTTGGGACAATAACAAATGTTGAGTATAAGGACACCGGAGAGACTTCTGGTTCTGTTGATGTTACATTTGATTTCTATGTTCCAGACGAAAGGTCTTGA
Predicted protein sequences of Glyma02g12540
>Glyma02g12540.1   sequence type=predicted peptide   gene model=Glyma02g12540   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAISGDLRVSATLPLYRSHSPPLRTSSQSSPKVDFHRFLNRACSISEFTPKCPYLTIVRCNMRGYCKPVAAVLGGPKFTSNSVSQETENFLLDAVKMNFFERLNLAWKIIFPSATSRKNSNARIAKQRLKMILFSDRCEVSDEAKRKIVSNVVRALSDFVEIESQDKVQLSVSADTDLGTIYSVTVPVRRVKPEYQEMDEFGTITNVEYKDTGETSGSVDVTFDFYVPDERS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo