Glyma02g11586 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g11586): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g11586): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g11586

Feature Type:	gene_model
Chromosome:	Gm02
Start:	9778755
stop:	9780914
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma02g11586

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G13730	AT	Annotation by Michelle Graham. TAIR10: cytochrome P450, family 90, subfamily D, polypeptide 1 \| chr3:4498330-4500836 REVERSE LENGTH=491	SoyBase	E_val: 6.00E-55	ISS
GO:0016132	GO-bp	Annotation by Michelle Graham. GO Biological Process: brassinosteroid biosynthetic process	SoyBase	N/A	ISS
GO:0048366	GO-bp	Annotation by Michelle Graham. GO Biological Process: leaf development	SoyBase	N/A	ISS
GO:0048441	GO-bp	Annotation by Michelle Graham. GO Biological Process: petal development	SoyBase	N/A	ISS
GO:0048443	GO-bp	Annotation by Michelle Graham. GO Biological Process: stamen development	SoyBase	N/A	ISS
GO:0055114	GO-bp	Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0005506	GO-mf	Annotation by Michelle Graham. GO Molecular Function: iron ion binding	SoyBase	N/A	ISS
GO:0009055	GO-mf	Annotation by Michelle Graham. GO Molecular Function: electron carrier activity	SoyBase	N/A	ISS
GO:0016705	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen	SoyBase	N/A	ISS
GO:0016709	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen	SoyBase	N/A	ISS
GO:0019825	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxygen binding	SoyBase	N/A	ISS
GO:0020037	GO-mf	Annotation by Michelle Graham. GO Molecular Function: heme binding	SoyBase	N/A	ISS
PTHR24286	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR24286:SF20	Panther		JGI		ISS
PF00067	PFAM	Cytochrome P450	JGI		ISS
UniRef100_A4PES5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Cytochrome P450 enzyme n=1 Tax=Pisum sativum RepID=A4PES5_PEA	SoyBase	E_val: 4.00E-71	ISS
UniRef100_UPI000233778C	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233778C related cluster n=1 Tax=unknown RepID=UPI000233778C	SoyBase	E_val: 2.00E-105	ISS

Expression Patterns of Glyma02g11586

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g11586 not represented in the dataset	Glyma02g11586 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g11586 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.02g104000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma02g11586

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma02g11586

Limit To All Plant Sequences

>Glyma02g11586.1   sequence type=CDS   gene model=Glyma02g11586   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAACTTCTAAAGAAGCATTTTCAAAAATTTATCTCAAGCCTCATGTCTCTACCAATAAAACTACCAATAACTAAACTCTATCAATCTTTGCAGGCAAAGAACAAAATTATCCTAGGTAAAAGAAATAATGGCATCTACAAAGTTCCAGAAGATGTGGTGGATGTCTTTCTTAGTGATGCTAGTGAAAAATTAACGGATGATTTAATAGTAGATAATATTATTGATATGATGATTCCAGGGGAAGACTTGGTGCCACTTCTTATGACTCTAGCTACAAAATATCTATTGGATTGTGCTATTGCTTTGCAACAATTGACGGGAAATTTGAAGCTTAAGAAACTTCAAGATCAACATGGGGAATCCTTGAGTTGGACCGATTACTTATCACTTCCATTTACTCAAACAGTCATCAGTGAAACTTTAAGGATGGGAAATATTATAATTGGAGTTATGAGAAAAGCCTTAAAAGATGTTGAAATAAAAAGGGCACTTAATACCAAAAGGGTGGTGTGTGTTTGCAAATTTTAG

Predicted protein sequences of Glyma02g11586

Limit To All Plant Sequences

>Glyma02g11586.1   sequence type=predicted peptide   gene model=Glyma02g11586   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MELLKKHFQKFISSLMSLPIKLPITKLYQSLQAKNKIILGKRNNGIYKVPEDVVDVFLSDASEKLTDDLIVDNIIDMMIPGEDLVPLLMTLATKYLLDCAIALQQLTGNLKLKKLQDQHGESLSWTDYLSLPFTQTVISETLRMGNIIIGVMRKALKDVEIKRALNTKRVVCVCKF*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain