SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g11540

Feature Type:gene_model
Chromosome:Gm02
Start:9742932
stop:9744304
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma02g11540
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G09990AT Annotation by Michelle Graham. TAIR10: Ribosomal protein S5 domain 2-like superfamily protein | chr2:3781442-3781882 FORWARD LENGTH=146 SoyBaseE_val: 1.00E-90ISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0005618GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell wall SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0022626GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome SoyBaseN/AISS
GO:0022627GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic small ribosomal subunit SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
KOG1753 KOG 40S ribosomal protein S16 JGI ISS
PTHR21569Panther RIBOSOMAL PROTEIN S9 JGI ISS
PF00380PFAM Ribosomal protein S9/S16 JGI ISS
UniRef100_I1KM19UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1KM19_SOYBN SoyBaseE_val: 2.00E-108ISS
UniRef100_I3NMP7UniRef Annotation by Michelle Graham. Most informative UniRef hit: 40S ribosomal protein S16B n=1 Tax=Hevea brasiliensis RepID=I3NMP7_HEVBR SoyBaseE_val: 5.00E-93ISS

Expression Patterns of Glyma02g11540
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma02g11540
ParalogEvidenceComments
Glyma07g33800 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma02g11540 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g103600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma02g11540
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma02g11540
>Glyma02g11540.1   sequence type=CDS   gene model=Glyma02g11540   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGCAGCCTCAGCCGCAGTCGCAGCCGCAGCACGGGCAAGCAGCGCTGGAGCAGGTGCAGTGCTTCGGTCGCAAGAAGACCGCCGTGGCCGTGACCTACTGCAAGCGCGGGCGCGGTCTCATCAAGATCAACGGCTGCCCCATTGAGCTCGTGGAGCCGGAGATCCTCCGCTTCAAGGCCTTCGAGCCTATCCTCCTGTTGGGTAAGAGCCGCTTCGCCGGCGTCGACATGCGCATCCGCGTCAAGGGTGGCGGCCACACCTCCCAGATCTACGCCATCCGCCAGAGCATCGCCAAGGCGCTCGTCGCGTTCTACCAGAAGTATGTCGACGAACAGAGTAAGAAGGAGATCAAGGACATTCTCGTGAGGTACGATCGCACCTTGCTCGTTGCGGATCCCAGGCGCTGCGAGCCCAAGAAGTTTGGTGGGCGTGGCGCACGTGCGAGGTTCCAGAAGTCTTACCGTTGA
Predicted protein sequences of Glyma02g11540
>Glyma02g11540.1   sequence type=predicted peptide   gene model=Glyma02g11540   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAQPQPQSQPQHGQAALEQVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELVEPEILRFKAFEPILLLGKSRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo