Glyma02g10990 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g10990): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g10990): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g10990

Feature Type:	gene_model
Chromosome:	Gm02
Start:	9144601
stop:	9144852
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma02g10990

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G59990	AT	Annotation by Michelle Graham. TAIR10: methionine aminopeptidase 2B \| chr3:22155921-22158551 REVERSE LENGTH=439	SoyBase	E_val: 6.00E-24	ISS
GO:0006508	GO-bp	Annotation by Michelle Graham. GO Biological Process: proteolysis	SoyBase	N/A	ISS
GO:0009987	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular process	SoyBase	N/A	ISS
GO:0010048	GO-bp	Annotation by Michelle Graham. GO Biological Process: vernalization response	SoyBase	N/A	ISS
GO:0016485	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein processing	SoyBase	N/A	ISS
GO:0051604	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein maturation	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0004177	GO-mf	Annotation by Michelle Graham. GO Molecular Function: aminopeptidase activity	SoyBase	N/A	ISS
GO:0008235	GO-mf	Annotation by Michelle Graham. GO Molecular Function: metalloexopeptidase activity	SoyBase	N/A	ISS
PTHR10804	Panther	PROTEASE FAMILY M24 (METHIONYL AMINOPEPTIDASE, AMINOPEPTIDASE P)	JGI		ISS
PTHR10804:SF9	Panther	gb def: peptidase [caenorhabditis elegans]	JGI		ISS
PF00557	PFAM	Metallopeptidase family M24	JGI		ISS
UniRef100_I1K1N3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Methionine aminopeptidase n=1 Tax=Glycine max RepID=I1K1N3_SOYBN	SoyBase	E_val: 6.00E-23	ISS
UniRef100_I1K1N3	UniRef	Annotation by Michelle Graham. Best UniRef hit: Methionine aminopeptidase n=1 Tax=Glycine max RepID=I1K1N3_SOYBN	SoyBase	E_val: 6.00E-23	ISS

Expression Patterns of Glyma02g10990

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g10990 not represented in the dataset	Glyma02g10990 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g10990 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma02g10990

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma02g10990

Limit To All Plant Sequences

>Glyma02g10990.1   sequence type=CDS   gene model=Glyma02g10990   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GTTGCTGCTCACTGGACCCCAAATTCATGGGATAAGACTATACTTCAGTGTGATGATGTGATGAAATTGGATTTTGGTACCCATGTTGATGGATATATAGTTGATTGTGCTTTTACCGTGGCATTCAACCCC

Predicted protein sequences of Glyma02g10990

Limit To All Plant Sequences

>Glyma02g10990.1   sequence type=predicted peptide   gene model=Glyma02g10990   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
VAAHWTPNSWDKTILQCDDVMKLDFGTHVDGYIVDCAFTVAFNP

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain