SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g10681

Feature Type:gene_model
Chromosome:Gm02
Start:8588996
stop:8591108
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma02g10681
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G35450AT Annotation by Michelle Graham. TAIR10: catalytics;hydrolases | chr2:14903201-14905361 REVERSE LENGTH=346 SoyBaseE_val: 2.00E-68ISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0016787GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity SoyBaseN/AISS
PF04909PFAM Amidohydrolase JGI ISS
UniRef100_B9RMA4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Aminocarboxymuconate-semialdehyde decarboxylase, putative n=1 Tax=Ricinus communis RepID=B9RMA4_RICCO SoyBaseE_val: 7.00E-70ISS
UniRef100_I1JDT7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1JDT7_SOYBN SoyBaseE_val: 9.00E-90ISS

Expression Patterns of Glyma02g10681
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g10681 not represented in the dataset
Glyma02g10681 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma02g10681
ParalogEvidenceComments
Glyma18g52130 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma02g10681 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma02g10681
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma02g10681
>Glyma02g10681.1   sequence type=CDS   gene model=Glyma02g10681   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCAATTCGTTTATTGGACAGCATTTTGAAGAAATACCCGACCAAATTTGTTGGTTGTTGTCTTACTAATCCAGCAGATGATGGAAGTGGGCTTAAGCAGTTTGAAGATCTTGTTTTGAAGGATGGTTATCGTGCTGTTCGATTCAACCCATATTTGTGGCCGCCCAGGGAAAAGATGACAAATAAAGTTGGGAAGGAAATTTTCCAAAGGGCTGGAGAACTCAATGTGCCAGTGGGCTTCATGTGTATGAAGGGGCTTGATCTGCATATTTCTGAAATTGAGCAATTGTGCACAGAATTCCCATCAACAGTTGTATTGCTTGATCACTTGGGCTTTTGCAAACCACCAATAAATGATGAAGACGGTCTTGTCTTTTCTCAACTTTTAAATCTGTCTAGATTCCCACAAGAGTACATTTGA
Predicted protein sequences of Glyma02g10681
>Glyma02g10681.1   sequence type=predicted peptide   gene model=Glyma02g10681   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSIRLLDSILKKYPTKFVGCCLTNPADDGSGLKQFEDLVLKDGYRAVRFNPYLWPPREKMTNKVGKEIFQRAGELNVPVGFMCMKGLDLHISEIEQLCTEFPSTVVLLDHLGFCKPPINDEDGLVFSQLLNLSRFPQEYI*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo