SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g10550

Feature Type:gene_model
Chromosome:Gm02
Start:8433192
stop:8435327
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma02g10550
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G55280AT Annotation by Michelle Graham. TAIR10: ribosomal protein L23AB | chr3:20500667-20501519 FORWARD LENGTH=154 SoyBaseE_val: 3.00E-68ISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0006979GO-bp Annotation by Michelle Graham. GO Biological Process: response to oxidative stress SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009644GO-bp Annotation by Michelle Graham. GO Biological Process: response to high light intensity SoyBaseN/AISS
GO:0042254GO-bp Annotation by Michelle Graham. GO Biological Process: ribosome biogenesis SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0022625GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic large ribosomal subunit SoyBaseN/AISS
GO:0022626GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0003723GO-mf Annotation by Michelle Graham. GO Molecular Function: RNA binding SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
KOG1751 KOG 60s ribosomal protein L23 JGI ISS
PTHR11620Panther 60S RIBOSOMAL PROTEIN L23A JGI ISS
PF00276PFAM Ribosomal protein L23 JGI ISS
PF03939PFAM Ribosomal protein L23, N-terminal domain JGI ISS
UniRef100_C6T5B2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T5B2_SOYBN SoyBaseE_val: 8.00E-105ISS
UniRef100_Q9AT35UniRef Annotation by Michelle Graham. Most informative UniRef hit: 60S ribosomal protein L23a n=1 Tax=Daucus carota RepID=RL23A_DAUCA SoyBaseE_val: 2.00E-79ISS

Expression Patterns of Glyma02g10550
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma02g10550
ParalogEvidenceComments
Glyma18g52310 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma02g10550 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g095000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma02g10550
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma02g10550
>Glyma02g10550.2   sequence type=CDS   gene model=Glyma02g10550   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTCCTACTAAGGTGGACAATGCCAAAAGGGCTGATCCCAAAGCTCAGGCCTTGAAGACAGCTAAGGCTGTCAAATCAAGTGGTCAAGTGTTTAGGAAGAAAGCTAAAAAGATCAGGACATCGGTTACATTTCACAGGCCAAGGACCTTGAAGAAGGAAAGGAACCCTAAGTACCCTCGCATTAGTGCTCCACCCAGAAACAAGTTGGACCATTATCAGATACTTAAATTTCCTCTAACTACTGAGTCTGCTATGAAGAAAATTGAGGATAACAACACGCTGGTTTTTATTGTTGACCTTCGTGCAAACAAGAAAAAGATTAAGGATGCTGTGAAGAAGATGTATGACATTCAGGCAAAGAAAGTCAATACATTAATCAGGCCGGATGGGACAAAGAAAGCCTATGTTAGGTTGACTCCAGATTATGATGCCTTGGATGTAGCTAACAAGATTGGTATCATCTAA
Predicted protein sequences of Glyma02g10550
>Glyma02g10550.2   sequence type=predicted peptide   gene model=Glyma02g10550   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAPTKVDNAKRADPKAQALKTAKAVKSSGQVFRKKAKKIRTSVTFHRPRTLKKERNPKYPRISAPPRNKLDHYQILKFPLTTESAMKKIEDNNTLVFIVDLRANKKKIKDAVKKMYDIQAKKVNTLIRPDGTKKAYVRLTPDYDALDVANKIGII*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo