SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Notice: fwrite(): Write of 157 bytes failed with errno=28 No space left on device in /var/www/html/include/SeqFeatClass.php on line 369

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g10520): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g10520): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g10520

Feature Type:gene_model
Chromosome:Gm02
Start:8409820
stop:8411518
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G01470AT Annotation by Michelle Graham. TAIR10: tonoplast intrinsic protein 1;3 | chr4:625092-625850 REVERSE LENGTH=252 SoyBaseE_val: 1.00E-152ISS
GO:0006810GO-bp Annotation by Michelle Graham. GO Biological Process: transport SoyBaseN/AISS
GO:0006833GO-bp Annotation by Michelle Graham. GO Biological Process: water transport SoyBaseN/AISS
GO:0015840GO-bp Annotation by Michelle Graham. GO Biological Process: urea transport SoyBaseN/AISS
GO:0055085GO-bp Annotation by Michelle Graham. GO Biological Process: transmembrane transport SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0016021GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane SoyBaseN/AISS
GO:0005215GO-mf Annotation by Michelle Graham. GO Molecular Function: transporter activity SoyBaseN/AISS
GO:0015204GO-mf Annotation by Michelle Graham. GO Molecular Function: urea transmembrane transporter activity SoyBaseN/AISS
GO:0015250GO-mf Annotation by Michelle Graham. GO Molecular Function: water channel activity SoyBaseN/AISS
KOG0223 KOG Aquaporin (major intrinsic protein family) JGI ISS
PTHR19139Panther AQUAPORIN TRANSPORTER JGI ISS
PTHR19139:SF54Panther SUBFAMILY NOT NAMED JGI ISS
PF00230PFAM Major intrinsic protein JGI ISS
UniRef100_D7M4V2UniRef Annotation by Michelle Graham. Most informative UniRef hit: GAMMA-TIP3/TIP1_3 n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7M4V2_ARALL SoyBaseE_val: 8.00E-151ISS
UniRef100_I1JDR9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JDR9_SOYBN SoyBaseE_val: 5.00E-175ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g10520 not represented in the dataset

Glyma02g10520 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma18g52360 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g094700 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma02g10520.1   sequence type=CDS   gene model=Glyma02g10520   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAATATATAGAATTGCAATTGGGACCCCTGGAGAGGCTGGCCAACCTGATGCAATCAGAGCAGCATTTGCAGAATTCTTCTCCATGATCATTTTTGTTTTTGCTGGGGAAGGATCTGGCATGGCTTACAGCAAACTTACCAACAATGGACCTGCAACACCAGCTGGTCTCATTGCTGCATCACTATCTCATGCATTTGGGCTTTTTGTGGCTGTCTCTGTTGGGGCAAACATTTCTGGTGGTCATGTAAACCCTGCAGTCACATTTGGTGCCTTCATAGGAGGAAACATAACCCTGTTGAGAAGTATTTTGTATTGGATTGCACAGTTGCTTGGTTCAGTTGTTGCATGCATTCTTCTCAAGTCTGCAACCGGTGGAATGGAAACAACAGGCTTTTCCCTATCACCTGGTGTGTCTGTCTGGAATGCATTAGTTTTTGAAATTGTGATGACTTTTGGGTTGGTATATACAGTTTATGCCACAGCAGTGGACCCAAAGAAAGGGAATGTGGGAGTTGTTGCACCAATTGCAATTGGCTTTATTGTGGGTGCCAACATCTTAGTTGGTGGTGCATTTGATGGTGCATCCATGAACCCAGCTGTGTCCTTTGGCCCTGCTGTGGTTACATGGTCATGGACCCATCACTGGGTCTATTGGGTTGGTCCATTCATTGGTGCAGCAATTGCTGCAGTAATCTATGATAATATCTTCATTGGAGATGATGGTCATGAACCTCTTTCAAGCAGTGATTTCTAG

>Glyma02g10520.1   sequence type=predicted peptide   gene model=Glyma02g10520   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAIYRIAIGTPGEAGQPDAIRAAFAEFFSMIIFVFAGEGSGMAYSKLTNNGPATPAGLIAASLSHAFGLFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRSILYWIAQLLGSVVACILLKSATGGMETTGFSLSPGVSVWNALVFEIVMTFGLVYTVYATAVDPKKGNVGVVAPIAIGFIVGANILVGGAFDGASMNPAVSFGPAVVTWSWTHHWVYWVGPFIGAAIAAVIYDNIFIGDDGHEPLSSSDF*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo