Glyma02g10450 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g10450

Feature Type:	gene_model
Chromosome:	Gm02
Start:	8348336
stop:	8353095
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma02g10450

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G59840	AT	Annotation by Michelle Graham. TAIR10: Ras-related small GTP-binding family protein \| chr5:24107450-24109049 REVERSE LENGTH=216	SoyBase	E_val: 1.00E-142	ISS
GO:0007264	GO-bp	Annotation by Michelle Graham. GO Biological Process: small GTPase mediated signal transduction	SoyBase	N/A	ISS
GO:0015031	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein transport	SoyBase	N/A	ISS
GO:0005794	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0009506	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma	SoyBase	N/A	ISS
GO:0005525	GO-mf	Annotation by Michelle Graham. GO Molecular Function: GTP binding	SoyBase	N/A	ISS
KOG0078	KOG	GTP-binding protein SEC4, small G protein superfamily, and related Ras family GTP-binding proteins	JGI		ISS
PTHR24073	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR24073:SF232	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF00071	PFAM	Ras family	JGI		ISS
UniRef100_Q41024	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Small GTP-binding protein n=1 Tax=Pisum sativum RepID=Q41024_PEA	SoyBase	E_val: 7.00E-149	ISS
UniRef100_UPI00019AA8EA	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI00019AA8EA related cluster n=1 Tax=unknown RepID=UPI00019AA8EA	SoyBase	E_val: 2.00E-157	ISS

Expression Patterns of Glyma02g10450

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma02g10450

Paralog	Evidence	Comments
Glyma18g52450	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma02g10450 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.02g094100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma02g10450

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma02g10450

Limit To All Plant Sequences

>Glyma02g10450.1   sequence type=CDS   gene model=Glyma02g10450   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAGCACCACCTGCGAGGGCACGTGCCGATTACGATTACCTCATCAAGCTTCTTCTTATTGGCGATAGCGGTGTCGGAAAGAGTTGTCTGCTTTTGCGATTTTCTGATGGTTCCTTCACAACCAGTTTTATCACCACCATTGGCATTGATTTTAAGATAAGAACCATTGAACTTGATGGCAAACGCATTAAGTTACAAATCTGGGATACTGCTGGTCAGGAGCGATTTCGAACTATTACCACAGCTTATTACCGTGGAGCCATGGGCATATTGCTTGTTTATGATGTTACTGATGAAGCATCTTTCAACAATATTAGGAATTGGATTCGCAACATTGAACAACATGCTTCTGACAATGTAAACAAGATACTTGTGGGTAACAAGGCTGATATGGATGAAAGTAAAAGGGCTGTGCCTACCTCCAAAGGTCAAGCCCTTGCTGATGAGTATGGTATCAAGTTTTTTGAAACCAGTGCGAAGACAAACATGAATGTGGAGGAGGTTTTCTTTTCAATAGCAAGAGATATCAAGCAAAGGCTTGCAGACACAGATTCTAAGGCTGAACCTCAGACTATCAAGATTAACCAACCCGACCAGGCAGCCACCGGGGGTCTAGCTGCTCAAAAATCGGCTTGCTGTGGTTCATGA

Predicted protein sequences of Glyma02g10450

Limit To All Plant Sequences

>Glyma02g10450.1   sequence type=predicted peptide   gene model=Glyma02g10450   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAAPPARARADYDYLIKLLLIGDSGVGKSCLLLRFSDGSFTTSFITTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGILLVYDVTDEASFNNIRNWIRNIEQHASDNVNKILVGNKADMDESKRAVPTSKGQALADEYGIKFFETSAKTNMNVEEVFFSIARDIKQRLADTDSKAEPQTIKINQPDQAATGGLAAQKSACCGS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain