SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g10195): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g10195): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g10195

Feature Type:gene_model
Chromosome:Gm02
Start:8079000
stop:8079761
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G12580AT Annotation by Michelle Graham. TAIR10: heat shock protein 70 | chr3:3991487-3993689 REVERSE LENGTH=650 SoyBaseE_val: 2.00E-58ISS
GO:0006457GO-bp Annotation by Michelle Graham. GO Biological Process: protein folding SoyBaseN/AISS
GO:0009266GO-bp Annotation by Michelle Graham. GO Biological Process: response to temperature stimulus SoyBaseN/AISS
GO:0009408GO-bp Annotation by Michelle Graham. GO Biological Process: response to heat SoyBaseN/AISS
GO:0009615GO-bp Annotation by Michelle Graham. GO Biological Process: response to virus SoyBaseN/AISS
GO:0009617GO-bp Annotation by Michelle Graham. GO Biological Process: response to bacterium SoyBaseN/AISS
GO:0009644GO-bp Annotation by Michelle Graham. GO Biological Process: response to high light intensity SoyBaseN/AISS
GO:0016567GO-bp Annotation by Michelle Graham. GO Biological Process: protein ubiquitination SoyBaseN/AISS
GO:0034976GO-bp Annotation by Michelle Graham. GO Biological Process: response to endoplasmic reticulum stress SoyBaseN/AISS
GO:0042542GO-bp Annotation by Michelle Graham. GO Biological Process: response to hydrogen peroxide SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0005618GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell wall SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0048046GO-cc Annotation by Michelle Graham. GO Cellular Compartment: apoplast SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0031625GO-mf Annotation by Michelle Graham. GO Molecular Function: ubiquitin protein ligase binding SoyBaseN/AISS
PTHR19375Panther HEAT SHOCK PROTEIN 70KDA JGI ISS
PTHR19375:SF1Panther HEAT SHOCK PROTEIN 70-RELATED JGI ISS
PF00012PFAM Hsp70 protein JGI ISS
UniRef100_G7IGB4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Heat shock 70 kDa protein n=1 Tax=Medicago truncatula RepID=G7IGB4_MEDTR SoyBaseE_val: 1.00E-68ISS
UniRef100_I1JDH9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=3 Tax=Glycine max RepID=I1JDH9_SOYBN SoyBaseE_val: 7.00E-78ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g10195 not represented in the dataset

Glyma02g10195 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g092200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma02g10195.1   sequence type=CDS   gene model=Glyma02g10195   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGATTTATGAGCTACTTCAATGGGAAGGGTCTGTGCATGAGTATCAACCCTAATGAGGCTGTTGCTTATGGCATTAAGAATGTTCCTGATTTGGTTCTGTTGGATGTTATGTCGCTGTCACTTGAAAACCTAACATCTGTTCAGATTAATGTGTATGAGGGCGAGAGAACAAGAGCTAGTGATAACAATTTACTGGGTTTTTTTAGTCTTTCTGGTTTTCCTCCTACTCCTCAGTACCATCCTTTTGATATATGCTTTGATATAGATGTGAATGGTATTTTATCTGTTTCTGCTGAGGAAAAAACCACCGGCTATAAGAATGATATTGCAATAACTAATGATGAAGGAAAATTGTCAGCAGAAGAAATTAAAAGAATGATTGAAAAAGCTGAGACTTACCAGGCTGAGGATAACAAGTTCCTTAGGAAGGCTAACGCAATGAATGCTTTGGATGATTACATTTACAAGATGAAAACGATTTTAAAGAAGGACGATATCAGCTTAAAGCTTTGCTCACAAGAAAGGCAGAAGATCAGTTTTGCAGTTACAAAGGCTACCAATTTGCTCCATGATGATAAACAACAGAATGAAGCAGTGGTGTTTGAGGATTCTCTGAAGGAGCTTGCCATTTGA

>Glyma02g10195.1   sequence type=predicted peptide   gene model=Glyma02g10195   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MRFMSYFNGKGLCMSINPNEAVAYGIKNVPDLVLLDVMSLSLENLTSVQINVYEGERTRASDNNLLGFFSLSGFPPTPQYHPFDICFDIDVNGILSVSAEEKTTGYKNDIAITNDEGKLSAEEIKRMIEKAETYQAEDNKFLRKANAMNALDDYIYKMKTILKKDDISLKLCSQERQKISFAVTKATNLLHDDKQQNEAVVFEDSLKELAI*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo