SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Notice: fwrite(): Write of 156 bytes failed with errno=28 No space left on device in /var/www/html/include/SeqFeatClass.php on line 369

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g09867): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g09867): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g09867

Feature Type:gene_model
Chromosome:Gm02
Start:7778697
stop:7779471
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G54830AT Annotation by Michelle Graham. TAIR10: nuclear factor Y, subunit C3 | chr1:20451672-20452325 FORWARD LENGTH=217 SoyBaseE_val: 2.00E-18ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0043565GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding SoyBaseN/AISS
PTHR10252Panther HISTONE-LIKE TRANSCRIPTION FACTOR CCAAT-RELATED JGI ISS
PTHR10252:SF6Panther CCAAT-BINDING TRANSCRIPTION FACTOR JGI ISS
PF00808PFAM Histone-like transcription factor (CBF/NF-Y) and archaeal histone JGI ISS
UniRef100_A8IYS8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Hypothetical transcription factor Hap5a-like protein (Fragment) n=1 Tax=Chlamydomonas reinhardtii RepID=A8IYS8_CHLRE SoyBaseE_val: 3.00E-16ISS
UniRef100_I1JDL8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1JDL8_SOYBN SoyBaseE_val: 1.00E-66ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g09867 not represented in the dataset

Glyma02g09867 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g089600 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma02g09867.1   sequence type=CDS   gene model=Glyma02g09867   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTTACTAAGCAGATGATCAGTTCTGAAATCCCCATGCTGATGTCAAAAGCATGTGAGATTTTCATTCAGGAGCTCACTTTTCGTGCTTGGATGCATGCTGAAAAGAACAACAAGAGTATTGTGCAGCCTTGTGACGTTGCCAAAGTTATCATGCAAACTGATACCATGAATTTCCTCACTGAGATTATTCCAAACAACCTCGGCGATTTCAGTGTTTTTGATGCCAAGGAAGAGAATATTGCAAACATTGCAGAAGAAAACGAAGTTTCTCTGTCTTTCACTGCTGGTTTTATGGGAAATCCTATGATGAAGATGGACAGTGTAAGTAAGAAGTAA

>Glyma02g09867.1   sequence type=predicted peptide   gene model=Glyma02g09867   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MFTKQMISSEIPMLMSKACEIFIQELTFRAWMHAEKNNKSIVQPCDVAKVIMQTDTMNFLTEIIPNNLGDFSVFDAKEENIANIAEENEVSLSFTAGFMGNPMMKMDSVSKK*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo