SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g09140

Feature Type:gene_model
Chromosome:Gm02
Start:7128718
stop:7134431
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma02g09140
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G43700AT Annotation by Michelle Graham. TAIR10: VIRE2-interacting protein 1 | chr1:16484352-16486017 FORWARD LENGTH=341 SoyBaseE_val: 7.00E-78ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0008272GO-bp Annotation by Michelle Graham. GO Biological Process: sulfate transport SoyBaseN/AISS
GO:0009294GO-bp Annotation by Michelle Graham. GO Biological Process: DNA mediated transformation SoyBaseN/AISS
GO:0009410GO-bp Annotation by Michelle Graham. GO Biological Process: response to xenobiotic stimulus SoyBaseN/AISS
GO:0009970GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to sulfate starvation SoyBaseN/AISS
GO:0030968GO-bp Annotation by Michelle Graham. GO Biological Process: endoplasmic reticulum unfolded protein response SoyBaseN/AISS
GO:0045596GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of cell differentiation SoyBaseN/AISS
GO:0045892GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0051170GO-bp Annotation by Michelle Graham. GO Biological Process: nuclear import SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0043565GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding SoyBaseN/AISS
GO:0046983GO-mf Annotation by Michelle Graham. GO Molecular Function: protein dimerization activity SoyBaseN/AISS
GO:0051019GO-mf Annotation by Michelle Graham. GO Molecular Function: mitogen-activated protein kinase binding SoyBaseN/AISS
PTHR22952Panther CAMP-RESPONSE ELEMENT BINDING PROTEIN-RELATED JGI ISS
PTHR22952:SF39Panther ATBZIP52 (ARABIDOPSIS THALIANA BASIC LEUCINE ZIPPE JGI ISS
PF00170PFAM bZIP transcription factor JGI ISS
UniRef100_I1JDF7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JDF7_SOYBN SoyBaseE_val: 0ISS
UniRef100_Q0GPF5UniRef Annotation by Michelle Graham. Most informative UniRef hit: BZIP transcription factor bZIP131 n=2 Tax=Glycine max RepID=Q0GPF5_SOYBN SoyBaseE_val: 0ISS

Expression Patterns of Glyma02g09140
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma02g09140
ParalogEvidenceComments
Glyma16g28370 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma02g09140 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g082800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma02g09140
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma02g09140
>Glyma02g09140.1   sequence type=CDS   gene model=Glyma02g09140   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAACCAGAAGTTCATCGGAAAGCCGCCGGCGACGGTGGACCTGGATCGGATGCCGGAGCGTGGGTCCCACCACCGGCGTTCCCACTCCGACACCTCCTTCCGCTTCGCCGCGAACTTCGACGACCTTCTCCTCTTCGACCCCTCCGACTTCGACATCTCCGGCCTCCCGTCGCCGCTCCCTCTGCCATCTCCGGTCTCCGCCGGCTTGGTTCCGATGTCCGTCGACTCCGACGAGTCCGGCAAACAGCCGAGGCCGGCCGGGGCGTCCGCCGGCGGGCACCTGCGGAGTCTGTCGGTGGATTCTGACTTCTTCGACGGGCTCGGGTTCGGCGGCGACGAGAGAGGCGCCGGGAAAGGAGGCGGCGGCGAGCGGAGGGTGGGGCACCACCGGCACAGCAACTCGATGGACGGGTCGTCGACGACGTCGTTTGAGGCGGACTCGGCGATGATAATGGACGGTGTGAAGAAAGCTATGGCTCCTGATAAACTTGCTGAACTTGCTCTTATGGATCCCAAGAGAGCTAAGAGGATTCTTGCTAACAGGCAATCTGCTGCAAGATCCAAGGAGAGGAAGATTCGTTACACAAGTGAGTTGGAGAGGAAGGTGCAGACTCTTCAGACTGAAGCAACTAACCTTTCTGCACAGCTTACCATGCTTCAGAGAGACACTACAGATTTGACTACAGAGAATAAGGAGCTCAAACTGCGTTTAGAGGCTTTGGAGCAGGAAGCACAGCTTAGAGAAGATCTCAATGAGGCATTGAAGGAAGAACTGCAGCGCCTTAGGGCACAAAGTACTCGTTTGGGTGCTATTGGTGGTAACCCTTCTTTTGGTGGGATATTCAACCAGTTGGCTTCCCAATTAGCCATGCAACAGTTGTCTAATTCTGCACCCCATCAGCAGACACAACACCAGCCACAGGTTGGCATGCCTCCTCCTCCCTCTGGACAGAACCACCCTAACTTCATGGACTTCAATCAGCAGAAGTAA
Predicted protein sequences of Glyma02g09140
>Glyma02g09140.1   sequence type=predicted peptide   gene model=Glyma02g09140   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNQKFIGKPPATVDLDRMPERGSHHRRSHSDTSFRFAANFDDLLLFDPSDFDISGLPSPLPLPSPVSAGLVPMSVDSDESGKQPRPAGASAGGHLRSLSVDSDFFDGLGFGGDERGAGKGGGGERRVGHHRHSNSMDGSSTTSFEADSAMIMDGVKKAMAPDKLAELALMDPKRAKRILANRQSAARSKERKIRYTSELERKVQTLQTEATNLSAQLTMLQRDTTDLTTENKELKLRLEALEQEAQLREDLNEALKEELQRLRAQSTRLGAIGGNPSFGGIFNQLASQLAMQQLSNSAPHQQTQHQPQVGMPPPPSGQNHPNFMDFNQQK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo