Glyma02g08820 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g08820

Feature Type:	gene_model
Chromosome:	Gm02
Start:	6823513
stop:	6824801
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma02g08820

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G59280	AT	Annotation by Michelle Graham. TAIR10: Protein Transporter, Pam16 \| chr3:21909266-21910519 REVERSE LENGTH=116	SoyBase	E_val: 4.00E-43	ISS
GO:0006626	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting to mitochondrion	SoyBase	N/A	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
PTHR12388	Panther	MITOCHONDRIA ASSOCIATED GRANULOCYTE MACROPHAGE CSF SIGNALING MOLECULE	JGI		ISS
PF03656	PFAM	Pam16	JGI		ISS
UniRef100_B9T034	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Mitochondria associated granulocyte macrophage csf signaling molecule, putative n=1 Tax=Ricinus communis RepID=B9T034_RICCO	SoyBase	E_val: 4.00E-41	ISS
UniRef100_C6T494	UniRef	Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6T494_SOYBN	SoyBase	E_val: 3.00E-56	ISS

Expression Patterns of Glyma02g08820

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma02g08820

Paralog	Evidence	Comments
Glyma16g27940	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma02g08820 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.02g080100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma02g08820

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma02g08820

Limit To All Plant Sequences

>Glyma02g08820.2   sequence type=CDS   gene model=Glyma02g08820   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CACAACAATGCAGCGGTTCTAGATCTTCTCATTTTCTTAACATTATGTTATGTTATTGCAGATGCCTCAAAAAATGGTGTTGCACAAGAGACAATTCAAAATACTATGCGCAGAGCTAGCAAGGTGATGACAGAGCAAGAGGCTAGGCAGATTCTTGGTGTTACCGAGGAAACTCCCTGGGAGGAGATTATCAAGAAATATGACAATTTGTTTGAGAATAATGCCAAAAATGGGAGTTTCTACCTCCAGTCCAAAGTTCATCGGGCCAAGGAATGTCTAGAGGCAGTTCAACAAGGCAAGAGCCAGGGTACCCCTAGTTGA

Predicted protein sequences of Glyma02g08820

Limit To All Plant Sequences

>Glyma02g08820.2   sequence type=predicted peptide   gene model=Glyma02g08820   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
HNNAAVLDLLIFLTLCYVIADASKNGVAQETIQNTMRRASKVMTEQEARQILGVTEETPWEEIIKKYDNLFENNAKNGSFYLQSKVHRAKECLEAVQQGKSQGTPS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain