|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G71695 | AT | Annotation by Michelle Graham. TAIR10: Peroxidase superfamily protein | chr1:26964359-26966557 FORWARD LENGTH=358 | SoyBase | E_val: 1.00E-33 | ISS |
| GO:0006979 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to oxidative stress | SoyBase | N/A | ISS |
| GO:0010075 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of meristem growth | SoyBase | N/A | ISS |
| GO:0048653 | GO-bp | Annotation by Michelle Graham. GO Biological Process: anther development | SoyBase | N/A | ISS |
| GO:0055114 | GO-bp | Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process | SoyBase | N/A | ISS |
| GO:0005576 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: extracellular region | SoyBase | N/A | ISS |
| GO:0005618 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cell wall | SoyBase | N/A | ISS |
| GO:0005773 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: vacuole | SoyBase | N/A | ISS |
| GO:0009505 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plant-type cell wall | SoyBase | N/A | ISS |
| GO:0009506 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma | SoyBase | N/A | ISS |
| GO:0016020 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: membrane | SoyBase | N/A | ISS |
| GO:0004601 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: peroxidase activity | SoyBase | N/A | ISS |
| GO:0020037 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: heme binding | SoyBase | N/A | ISS |
| PF00141 | PFAM | Peroxidase | JGI | ISS | |
| UniRef100_G7IEW3 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Peroxidase n=1 Tax=Medicago truncatula RepID=G7IEW3_MEDTR | SoyBase | E_val: 3.00E-53 | ISS |
| UniRef100_I1JDC6 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1JDC6_SOYBN | SoyBase | E_val: 2.00E-76 | ISS |
|
Glyma02g08780 not represented in the dataset |
Glyma02g08780 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma02g08780.2 sequence type=CDS gene model=Glyma02g08780 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGTTGGTGTGCTAGTTATACGTGTTGTTCCTCTATCGATCGATATTTTAGGAGCTCAGACGGTGTTTCTTGAAGAAGACGGAACACGTGATCTCCCCAAACCCTTCAACACCACCGGCGTTTTCACCGCCAAAAACTTTGATGTCACCGACGTTGTCGCCTTATCCGGCACACACACCTGCGGCACATTCTTCAACAGGCTCTCCCCTCTCGACCCCAACATAGACAAAACCCTAGCGAAGCAACTCCAGTCCACGTGCCCCGACGCAAACTCCGGCAACACCGCTAACTTGGACATCAGAACCCCGACACTGTTCGACAACAAGTACTACCTCGACCTAATGAACCGCCAGGGCGTGTTCACCTCGGATCAGGACTTGCTCAGTGATAAGCGGACTAAAGCGTTGGTGAATGCATTTGCATTGAATTAG
>Glyma02g08780.2 sequence type=predicted peptide gene model=Glyma02g08780 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MVGVLVIRVVPLSIDILGAQTVFLEEDGTRDLPKPFNTTGVFTAKNFDVTDVVALSGTHTCGTFFNRLSPLDPNIDKTLAKQLQSTCPDANSGNTANLDIRTPTLFDNKYYLDLMNRQGVFTSDQDLLSDKRTKALVNAFALN*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||