|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT5G48100 | AT | Annotation by Michelle Graham. TAIR10: Laccase/Diphenol oxidase family protein | chr5:19489530-19492582 REVERSE LENGTH=565 | SoyBase | E_val: 2.00E-15 | ISS |
GO:0009809 | GO-bp | Annotation by Michelle Graham. GO Biological Process: lignin biosynthetic process | SoyBase | N/A | ISS |
GO:0009813 | GO-bp | Annotation by Michelle Graham. GO Biological Process: flavonoid biosynthetic process | SoyBase | N/A | ISS |
GO:0010023 | GO-bp | Annotation by Michelle Graham. GO Biological Process: proanthocyanidin biosynthetic process | SoyBase | N/A | ISS |
GO:0046274 | GO-bp | Annotation by Michelle Graham. GO Biological Process: lignin catabolic process | SoyBase | N/A | ISS |
GO:0046688 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to copper ion | SoyBase | N/A | ISS |
GO:0055114 | GO-bp | Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process | SoyBase | N/A | ISS |
GO:0005576 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: extracellular region | SoyBase | N/A | ISS |
GO:0048046 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: apoplast | SoyBase | N/A | ISS |
GO:0005507 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: copper ion binding | SoyBase | N/A | ISS |
GO:0016491 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity | SoyBase | N/A | ISS |
GO:0052716 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: hydroquinone:oxygen oxidoreductase activity | SoyBase | N/A | ISS |
PTHR11709 | Panther | MULTI-COPPER OXIDASE | JGI | ISS | |
PTHR11709:SF9 | Panther | LACCASE | JGI | ISS | |
PF07732 | PFAM | Multicopper oxidase | JGI | ISS | |
UniRef100_G7J6C9 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Laccase-15 n=1 Tax=Medicago truncatula RepID=G7J6C9_MEDTR | SoyBase | E_val: 3.00E-20 | ISS |
UniRef100_UPI000233738E | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI000233738E related cluster n=1 Tax=unknown RepID=UPI000233738E | SoyBase | E_val: 4.00E-52 | ISS |
Glyma02g08382 not represented in the dataset |
Glyma02g08382 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma.02g076400 | Wm82.a2.v1 | IGC | As supplied by JGI |
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma02g08382.1 sequence type=CDS gene model=Glyma02g08382 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGAAAATGTGGCTTGACAAGAAAATTATCTTCCTTCTAACTCTGATTTGTTTTTCCTTAGTTGGAATCAATTCCCATGGATTGAAGGAATACCATTTTGTTGTCAAAGAAGCTCATTATAGAAGACTCTGCAGCTCAAAACCCATATTGACAGTGAATGGACAATTTCCAGGACCAATTATTAGAGCCTACTATGGCGAAACGATATTTGTCAATGTTCACAACAAGGGAAAATACGACATCACCTTGCACTTGTATTGA
>Glyma02g08382.1 sequence type=predicted peptide gene model=Glyma02g08382 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MKMWLDKKIIFLLTLICFSLVGINSHGLKEYHFVVKEAHYRRLCSSKPILTVNGQFPGPIIRAYYGETIFVNVHNKGKYDITLHLY*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||