SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g08170): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g08170): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g08170

Feature Type:gene_model
Chromosome:Gm02
Start:6391122
stop:6396383
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G13570AT Annotation by Michelle Graham. TAIR10: decapping 2 | chr5:4367532-4369992 FORWARD LENGTH=373 SoyBaseE_val: 4.00E-163ISS
GO:0000956GO-bp Annotation by Michelle Graham. GO Biological Process: nuclear-transcribed mRNA catabolic process SoyBaseN/AISS
GO:0006402GO-bp Annotation by Michelle Graham. GO Biological Process: mRNA catabolic process SoyBaseN/AISS
GO:0006635GO-bp Annotation by Michelle Graham. GO Biological Process: fatty acid beta-oxidation SoyBaseN/AISS
GO:0009791GO-bp Annotation by Michelle Graham. GO Biological Process: post-embryonic development SoyBaseN/AISS
GO:0010072GO-bp Annotation by Michelle Graham. GO Biological Process: primary shoot apical meristem specification SoyBaseN/AISS
GO:0016441GO-bp Annotation by Michelle Graham. GO Biological Process: posttranscriptional gene silencing SoyBaseN/AISS
GO:0016558GO-bp Annotation by Michelle Graham. GO Biological Process: protein import into peroxisome matrix SoyBaseN/AISS
GO:0031087GO-bp Annotation by Michelle Graham. GO Biological Process: deadenylation-independent decapping of nuclear-transcribed mRNA SoyBaseN/AISS
GO:0044265GO-bp Annotation by Michelle Graham. GO Biological Process: cellular macromolecule catabolic process SoyBaseN/AISS
GO:0000932GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasmic mRNA processing body SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0000287GO-mf Annotation by Michelle Graham. GO Molecular Function: magnesium ion binding SoyBaseN/AISS
GO:0003729GO-mf Annotation by Michelle Graham. GO Molecular Function: mRNA binding SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0016787GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity SoyBaseN/AISS
GO:0030145GO-mf Annotation by Michelle Graham. GO Molecular Function: manganese ion binding SoyBaseN/AISS
GO:0042803GO-mf Annotation by Michelle Graham. GO Molecular Function: protein homodimerization activity SoyBaseN/AISS
GO:0050072GO-mf Annotation by Michelle Graham. GO Molecular Function: m7G(5')pppN diphosphatase activity SoyBaseN/AISS
KOG2937 KOG Decapping enzyme complex, predicted pyrophosphatase DCP2 JGI ISS
PTHR23114Panther FAMILY NOT NAMED JGI ISS
PTHR23114:SF3Panther SUBFAMILY NOT NAMED JGI ISS
PF00293PFAM NUDIX domain JGI ISS
PF05026PFAM Dcp2, box A domain JGI ISS
UniRef100_C6TF29UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TF29_SOYBN SoyBaseE_val: 0ISS
UniRef100_Q8GW31UniRef Annotation by Michelle Graham. Most informative UniRef hit: mRNA-decapping enzyme subunit 2 n=1 Tax=Arabidopsis thaliana RepID=DCP2_ARATH SoyBaseE_val: 2.00E-160ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g08170 not represented in the dataset

Glyma02g08170 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma16g27200 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g074100 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma02g08170.1   sequence type=CDS   gene model=Glyma02g08170   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCTAATCATCACCGTTCTTCCTCCAAGAACGGTCTTCCACCTCAAGAACTCCTTGACGATCTCTGCAGCCGATTTGTGCTAAATGTGCCAAAGGAAGATCTTCAGTCATTTGAAAGGATCTTGTTTCTTGTGGAGTACGCACATTGGTTTTATGAAGATAATTCTGTAGAAAATAATCCATCTCTGAAGTCATTAAATCTGAAGGAGTTCACTTCTTTACTGTTCAATAGCTGTGATGTTTTGAAGCCTTATGTGGCCCATATAGATGATATTTTCAAGGACTTCACTTCCTATAAGGTTCGAGTTCCTGTAACTGGGGCAATAATTCTTGATGAAACATATGAAAGGTGCTTGCTAGTGAAGGGATGGAAAGGTTCAAGCTGGAGCTTCCCTCGTGGAAAAAAGAGCAAAGACGAAGAAGATCATGCATGTGCCATTAGAGAAGTCATGGAAGAAACAGGTTTTGATGTTTCAAAACTTCTGAACAAGGATGAATACCTTGAAGTTATTTTTGGACAACAGAGAGTTAGGCTTTACATTATTGCTGGAGTGAAAGATGATACAGCATTTGCTCCTCTTACCAAAAAGGAAATCAGTGAAATAGCATGGCACCGGCTTGATGAACTTCAACCAGCAAGTGATGAAGTGATATCGCGTAGCATCACCGGCCTTAAGCTTTATATGGTGGCCCCTTTTCTAGCATCATTGAAATCATGGATTTCAACACACCAACCTGCTATGGCTCCAAGGCCCGATTTGCCTCTTAAAGGAATTTGCGTGTGGAAAGCAAAACCCGGTTCTATTGGAAGTAGCTCCACAGTAATGGATATCCAGCCAACAAAACCTGAACCTGATTCTCACACCCCTGACCTGGGGCCTGGCAAGAGCTTTAGGAATTTCAGATTTGATACTGCCTCGATTTTACAAGCAATGGAAACTTCCTTTTCTTCTTGA

>Glyma02g08170.1   sequence type=predicted peptide   gene model=Glyma02g08170   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSNHHRSSSKNGLPPQELLDDLCSRFVLNVPKEDLQSFERILFLVEYAHWFYEDNSVENNPSLKSLNLKEFTSLLFNSCDVLKPYVAHIDDIFKDFTSYKVRVPVTGAIILDETYERCLLVKGWKGSSWSFPRGKKSKDEEDHACAIREVMEETGFDVSKLLNKDEYLEVIFGQQRVRLYIIAGVKDDTAFAPLTKKEISEIAWHRLDELQPASDEVISRSITGLKLYMVAPFLASLKSWISTHQPAMAPRPDLPLKGICVWKAKPGSIGSSSTVMDIQPTKPEPDSHTPDLGPGKSFRNFRFDTASILQAMETSFSS*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo