Glyma02g08040 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g08040): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g08040): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g08040

Feature Type:	gene_model
Chromosome:	Gm02
Start:	6303968
stop:	6306159
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma02g08040

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G03800	AT	Annotation by Michelle Graham. TAIR10: syntaxin of plants 131 \| chr3:969314-971460 FORWARD LENGTH=306	SoyBase	E_val: 9.00E-57	ISS
GO:0006886	GO-bp	Annotation by Michelle Graham. GO Biological Process: intracellular protein transport	SoyBase	N/A	ISS
GO:0016192	GO-bp	Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0005484	GO-mf	Annotation by Michelle Graham. GO Molecular Function: SNAP receptor activity	SoyBase	N/A	ISS
PTHR19957	Panther	SYNTAXIN	JGI		ISS
PTHR19957:SF26	Panther	SYNTAXIN, ARABIDOPSIS THALIANA	JGI		ISS
PF00804	PFAM	Syntaxin	JGI		ISS
UniRef100_A0F0A7	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Syntaxin (Fragment) n=1 Tax=Nicotiana benthamiana RepID=A0F0A7_NICBE	SoyBase	E_val: 2.00E-58	ISS
UniRef100_I1MNV4	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1MNV4_SOYBN	SoyBase	E_val: 2.00E-71	ISS

Expression Patterns of Glyma02g08040

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g08040 not represented in the dataset	Glyma02g08040 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g08040 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.02g072900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma02g08040

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma02g08040

Limit To All Plant Sequences

>Glyma02g08040.1   sequence type=CDS   gene model=Glyma02g08040   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GGTGACGTTGAGTTAGGAGAATATGCAAGGAATTCAGGAGACTTGGGCTTGGATAGTTTTTTCAAAAAGGTTCAAGAGCTTGATAAACAATATGCCAAGCTGGATAAGCTTTTGAAAAAGCTCCAGGATGCCCATGAGGAATCCAAAGCCGTGACCAAGGCTCCTTCCATGAAGGCTATAAAGCAGAGAATGGAGAAAGATGTTGATGAAGTTAAGAAAACTGCACATTACTTAAAGACCAAAATTGAAGAACTGGACAAAGAAAATTTGGCAAACGGGTGTGGAAAAGGATCAGGTGCTGACCGGTCAAGAACAGCAACAACCATTTCTTTAAAAAAGAAACTGAAAGATACTGAATTTCAGATCCTGAGAGAGGCCATCCATCAAGAGTAT

Predicted protein sequences of Glyma02g08040

Limit To All Plant Sequences

>Glyma02g08040.1   sequence type=predicted peptide   gene model=Glyma02g08040   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GDVELGEYARNSGDLGLDSFFKKVQELDKQYAKLDKLLKKLQDAHEESKAVTKAPSMKAIKQRMEKDVDEVKKTAHYLKTKIEELDKENLANGCGKGSGADRSRTATTISLKKKLKDTEFQILREAIHQEY

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain