Glyma02g08030 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g08030): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g08030): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g08030

Feature Type:	gene_model
Chromosome:	Gm02
Start:	6301655
stop:	6303010
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma02g08030

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G08080	AT	Annotation by Michelle Graham. TAIR10: syntaxin of plants 132 \| chr5:2588532-2591106 FORWARD LENGTH=304	SoyBase	E_val: 7.00E-36	ISS
GO:0006886	GO-bp	Annotation by Michelle Graham. GO Biological Process: intracellular protein transport	SoyBase	N/A	ISS
GO:0009737	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus	SoyBase	N/A	ISS
GO:0016192	GO-bp	Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005802	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: trans-Golgi network	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0009504	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cell plate	SoyBase	N/A	ISS
GO:0009506	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma	SoyBase	N/A	ISS
GO:0005484	GO-mf	Annotation by Michelle Graham. GO Molecular Function: SNAP receptor activity	SoyBase	N/A	ISS
PTHR19957	Panther	SYNTAXIN	JGI		ISS
PTHR19957:SF26	Panther	SYNTAXIN, ARABIDOPSIS THALIANA	JGI		ISS
PF05739	PFAM	SNARE domain	JGI		ISS
UniRef100_B9SIA7	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Syntaxin, putative n=1 Tax=Ricinus communis RepID=B9SIA7_RICCO	SoyBase	E_val: 8.00E-35	ISS
UniRef100_UPI0002337384	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI0002337384 related cluster n=1 Tax=unknown RepID=UPI0002337384	SoyBase	E_val: 6.00E-65	ISS

Expression Patterns of Glyma02g08030

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g08030 not represented in the dataset	Glyma02g08030 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g08030 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma02g08030

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma02g08030

Limit To All Plant Sequences

>Glyma02g08030.1   sequence type=CDS   gene model=Glyma02g08030   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATAATGGACACCTTGGCTGAAATTCAAGAGCAAGATGAAGCAGTTAGAGATGTTGAGAGTAAGCTTCTTGATTTACCACAGTTATTTAATCAGTTGATATTTCTGGATATTTCAGTGTTAGTGGATGCGCAAGGAGACATGCTTGACAACATAGAAACACAGGTTTCAAGTGCAGTGGATCACGTGCATCAAGGAAACAATGCCCTCCAGAAGGCAAAGAAACTACAAAGGAACTCTAGAAAATGGATGTGCATTGCAATCATGATCGTTGTTATAATAATTGTTGTTGCTATCATCAAACCACGG

Predicted protein sequences of Glyma02g08030

Limit To All Plant Sequences

>Glyma02g08030.1   sequence type=predicted peptide   gene model=Glyma02g08030   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
IMDTLAEIQEQDEAVRDVESKLLDLPQLFNQLIFLDISVLVDAQGDMLDNIETQVSSAVDHVHQGNNALQKAKKLQRNSRKWMCIAIMIVVIIIVVAIIKPR

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain