SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g07650

Feature Type:gene_model
Chromosome:Gm02
Start:6041770
stop:6042409
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma02g07650
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G65480AT Annotation by Michelle Graham. TAIR10: PEBP (phosphatidylethanolamine-binding protein) family protein | chr1:24331510-24333689 FORWARD LENGTH=175 SoyBaseE_val: 1.00E-33ISS
GO:0009909GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of flower development SoyBaseN/AISS
GO:0009911GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of flower development SoyBaseN/AISS
GO:0010119GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of stomatal movement SoyBaseN/AISS
GO:0048573GO-bp Annotation by Michelle Graham. GO Biological Process: photoperiodism, flowering SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0008429GO-mf Annotation by Michelle Graham. GO Molecular Function: phosphatidylethanolamine binding SoyBaseN/AISS
PTHR11362Panther PHOSPHATIDYLETHANOLAMINE-BINDING PROTEIN JGI ISS
UniRef100_E3NYP3UniRef Annotation by Michelle Graham. Most informative UniRef hit: FT-like protein n=2 Tax=Glycine max RepID=E3NYP3_SOYBN SoyBaseE_val: 6.00E-37ISS
UniRef100_I1JD31UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JD31_SOYBN SoyBaseE_val: 8.00E-39ISS

Proteins Associated with Glyma02g07650
LocusGene SymbolProtein Name
FT FLOWERING LOCUS T

Expression Patterns of Glyma02g07650
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma02g07650
ParalogEvidenceComments
Glyma16g26660 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma02g07650 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g069500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma02g07650
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma02g07650
>Glyma02g07650.1   sequence type=CDS   gene model=Glyma02g07650   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATGGGGATTCATCGTTTAGTGTTTGTGTTATTTCGTCAACTGGGTAGGGAAACAGTGTATGCACCAGGATGGCGCCAGAATTTCAACACTAGAGAATTTGCTGAACTCTACAACCTTGGATTGCCAGTTGCTGCTGTCTATTTCAACATTCAGAGGGAATCTGGCTCTGGTGGAAGAAGGTTATACCATTGA
Predicted protein sequences of Glyma02g07650
>Glyma02g07650.1   sequence type=predicted peptide   gene model=Glyma02g07650   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MMGIHRLVFVLFRQLGRETVYAPGWRQNFNTREFAELYNLGLPVAAVYFNIQRESGSGGRRLYH*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo