|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT3G61110 | AT | Annotation by Michelle Graham. TAIR10: ribosomal protein S27 | chr3:22611710-22612632 FORWARD LENGTH=86 | SoyBase | E_val: 1.00E-57 | ISS |
| GO:0001510 | GO-bp | Annotation by Michelle Graham. GO Biological Process: RNA methylation | SoyBase | N/A | ISS |
| GO:0006412 | GO-bp | Annotation by Michelle Graham. GO Biological Process: translation | SoyBase | N/A | ISS |
| GO:0009664 | GO-bp | Annotation by Michelle Graham. GO Biological Process: plant-type cell wall organization | SoyBase | N/A | ISS |
| GO:0042254 | GO-bp | Annotation by Michelle Graham. GO Biological Process: ribosome biogenesis | SoyBase | N/A | ISS |
| GO:0042545 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell wall modification | SoyBase | N/A | ISS |
| GO:0005618 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cell wall | SoyBase | N/A | ISS |
| GO:0005622 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: intracellular | SoyBase | N/A | ISS |
| GO:0005737 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm | SoyBase | N/A | ISS |
| GO:0005840 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: ribosome | SoyBase | N/A | ISS |
| GO:0009506 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma | SoyBase | N/A | ISS |
| GO:0022626 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome | SoyBase | N/A | ISS |
| GO:0022627 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosolic small ribosomal subunit | SoyBase | N/A | ISS |
| GO:0003735 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome | SoyBase | N/A | ISS |
| KOG1779 | KOG | 40s ribosomal protein S27 | JGI | ISS | |
| PTHR11594 | Panther | 40S RIBOSOMAL PROTEIN S27 | JGI | ISS | |
| PF01667 | PFAM | Ribosomal protein S27 | JGI | ISS | |
| UniRef100_B7FHA3 | UniRef | Annotation by Michelle Graham. Best UniRef hit: 40S ribosomal protein S27 n=6 Tax=Papilionoideae RepID=B7FHA3_MEDTR | SoyBase | E_val: 2.00E-56 | ISS |
| UniRef100_B7FHA3 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: 40S ribosomal protein S27 n=6 Tax=Papilionoideae RepID=B7FHA3_MEDTR | SoyBase | E_val: 2.00E-56 | ISS |
|
Glyma02g07430 not represented in the dataset |
Glyma02g07430 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.02g067400 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma02g07430.1 sequence type=CDS gene model=Glyma02g07430 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGTTCTTCAGAATGATATTGATTTGCTGAATCCTCCAGCTGAGTTGGAGAAGAGAAAGCACAAACTCAAGCGTCTTGTTCAGTCACCAAACTCTTTCTTCATGGATGTTAAGTGCCAGGGATGCTTCAACATAACAACTGTGTTTAGCCACTCTCAAACTGTTGTGGTGTGCGGAAACTGCCAGACTGTTTTGTGCCAACCAACAGGGGGACGGGCGAGGTTAACCGAAGGTTGCTCATTTAGGAAGAAGGGAGATTGA
>Glyma02g07430.1 sequence type=predicted peptide gene model=Glyma02g07430 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MVLQNDIDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLCQPTGGRARLTEGCSFRKKGD*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||