Glyma02g07021 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g07021): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g07021): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g07021

Feature Type:	gene_model
Chromosome:	Gm02
Start:	5622063
stop:	5622552
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma02g07021

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G23620	AT	Annotation by Michelle Graham. TAIR10: methyl esterase 1 \| chr2:10047462-10049248 REVERSE LENGTH=263	SoyBase	E_val: 5.00E-28	ISS
GO:0009627	GO-bp	Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance	SoyBase	N/A	ISS
GO:0009696	GO-bp	Annotation by Michelle Graham. GO Biological Process: salicylic acid metabolic process	SoyBase	N/A	ISS
GO:0009817	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response to fungus, incompatible interaction	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0016788	GO-mf	Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, acting on ester bonds	SoyBase	N/A	ISS
GO:0080030	GO-mf	Annotation by Michelle Graham. GO Molecular Function: methyl indole-3-acetate esterase activity	SoyBase	N/A	ISS
GO:0080031	GO-mf	Annotation by Michelle Graham. GO Molecular Function: methyl salicylate esterase activity	SoyBase	N/A	ISS
GO:0080032	GO-mf	Annotation by Michelle Graham. GO Molecular Function: methyl jasmonate esterase activity	SoyBase	N/A	ISS
PTHR10992	Panther	ALPHA/BETA HYDROLASE RELATED	JGI		ISS
PTHR10992:SF56	Panther	gb def: abhydrolase, alpha/beta hydrolase fold [bacillus anthracis a2012]	JGI		ISS
UniRef100_G8A1F6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Esterase PIR7B n=1 Tax=Medicago truncatula RepID=G8A1F6_MEDTR	SoyBase	E_val: 7.00E-30	ISS
UniRef100_I1JCW5	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1JCW5_SOYBN	SoyBase	E_val: 4.00E-60	ISS

Expression Patterns of Glyma02g07021

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g07021 not represented in the dataset	Glyma02g07021 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g07021 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.02g063200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma02g07021

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma02g07021

Limit To All Plant Sequences

>Glyma02g07021.1   sequence type=CDS   gene model=Glyma02g07021   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGAGGACCCCGTCGTCTGCATGGTTGGACACAGAATTTGCTCCAAGACCTTGAATTGGCCAAGACTTTAGTAAGACCATCGTCACTCGTCGTTGAAGACTTGTCTAAGCAGAAGAACTTCTCCAAAGAGGGATATGGGTCAGTTCCACGAGCGTATATTGTTTGCACTAAGGACATTGCAATTCCATTGGAATATCAGCTTTTGATGATAAAAAATACTGGGTTCAACGACGTTCTAAAGATCAAAGGCGCAGATCATATGCCTATGAATAGCAAGCCTCGAGAACTATTCGATTCTCTCGAAAAGATAGCTACTAAATATGCATAA

Predicted protein sequences of Glyma02g07021

Limit To All Plant Sequences

>Glyma02g07021.1   sequence type=predicted peptide   gene model=Glyma02g07021   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MRGPRRLHGWTQNLLQDLELAKTLVRPSSLVVEDLSKQKNFSKEGYGSVPRAYIVCTKDIAIPLEYQLLMIKNTGFNDVLKIKGADHMPMNSKPRELFDSLEKIATKYA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain