Glyma02g06870 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g06870): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g06870): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g06870

Feature Type:	gene_model
Chromosome:	Gm02
Start:	5515337
stop:	5517483
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma02g06870

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G37200	AT	Annotation by Michelle Graham. TAIR10: Thioredoxin superfamily protein \| chr4:17509836-17511230 REVERSE LENGTH=261	SoyBase	E_val: 4.00E-22	ISS
GO:0006662	GO-bp	Annotation by Michelle Graham. GO Biological Process: glycerol ether metabolic process	SoyBase	N/A	ISS
GO:0010190	GO-bp	Annotation by Michelle Graham. GO Biological Process: cytochrome b6f complex assembly	SoyBase	N/A	ISS
GO:0019761	GO-bp	Annotation by Michelle Graham. GO Biological Process: glucosinolate biosynthetic process	SoyBase	N/A	ISS
GO:0045454	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell redox homeostasis	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009534	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid	SoyBase	N/A	ISS
GO:0009535	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane	SoyBase	N/A	ISS
GO:0031977	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: thylakoid lumen	SoyBase	N/A	ISS
GO:0009055	GO-mf	Annotation by Michelle Graham. GO Molecular Function: electron carrier activity	SoyBase	N/A	ISS
GO:0015035	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein disulfide oxidoreductase activity	SoyBase	N/A	ISS
GO:0016671	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor	SoyBase	N/A	ISS
PTHR10438	Panther	THIOREDOXIN-RELATED	JGI		ISS
PTHR10438:SF103	Panther	OS03G0767500 PROTEIN	JGI		ISS
UniRef100_G7K9G6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Protein disulfide-isomerase n=1 Tax=Medicago truncatula RepID=G7K9G6_MEDTR	SoyBase	E_val: 1.00E-27	ISS
UniRef100_I1JCV1	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JCV1_SOYBN	SoyBase	E_val: 8.00E-108	ISS

Expression Patterns of Glyma02g06870

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g06870 not represented in the dataset	Glyma02g06870 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g06870 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.02g061600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma02g06870

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma02g06870

Limit To All Plant Sequences

>Glyma02g06870.1   sequence type=CDS   gene model=Glyma02g06870   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTGCTTCTCTTTAAACCTCTCAGCTCTTCACATGTTCAGACCATGCGTATATATTCCTCAAATCGTTGCAAATCCATTGCAGCATCAGAATCGTAAAATCAAGATCTTAGCTTGCCAAGCTAATCAAAATCTTGACCAATCGTCCACAACGGAAAAATCTGTTGCTGAGCTTGGCAATAGCAAAGGAACAAGTTCCCCAAATGGTGTTCCCCCTAAATTCCCAAGCAAGGATTTCAAGAAGAAAATTGCCATTGTTTCCTTTTTAGGAGCTCTGGGACTTTTATTATCTTCAAGGCTTCACTTCTTTGGTGTTCCTATGAAGGATCACTGTGCTCATGCATTACCATCCAAAGAGGCTCGGCCCAATGGGAAGTTCACTGTGGTGGAGTTTAATGCAGATTGGTGTGAAGTACGTGGGGAATTAGCTCCTGATGTGTACGAAGTAGAGTAG

Predicted protein sequences of Glyma02g06870

Limit To All Plant Sequences

>Glyma02g06870.1   sequence type=predicted peptide   gene model=Glyma02g06870   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MACFSLNLSALHMFRPCVYIPQIVANPLQHQNRKIKILACQANQNLDQSSTTEKSVAELGNSKGTSSPNGVPPKFPSKDFKKKIAIVSFLGALGLLLSSRLHFFGVPMKDHCAHALPSKEARPNGKFTVVEFNADWCEVRGELAPDVYEVE*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain