Glyma02g06781 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g06781): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g06781): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g06781

Feature Type:	gene_model
Chromosome:	Gm02
Start:	5433669
stop:	5434167
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma02g06781

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G62410	AT	Annotation by Michelle Graham. TAIR10: structural maintenance of chromosomes 2 \| chr5:25056308-25062436 FORWARD LENGTH=1175	SoyBase	E_val: 8.00E-23	ISS
GO:0000911	GO-bp	Annotation by Michelle Graham. GO Biological Process: cytokinesis by cell plate formation	SoyBase	N/A	ISS
GO:0006260	GO-bp	Annotation by Michelle Graham. GO Biological Process: DNA replication	SoyBase	N/A	ISS
GO:0006261	GO-bp	Annotation by Michelle Graham. GO Biological Process: DNA-dependent DNA replication	SoyBase	N/A	ISS
GO:0006270	GO-bp	Annotation by Michelle Graham. GO Biological Process: DNA replication initiation	SoyBase	N/A	ISS
GO:0006275	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of DNA replication	SoyBase	N/A	ISS
GO:0006306	GO-bp	Annotation by Michelle Graham. GO Biological Process: DNA methylation	SoyBase	N/A	ISS
GO:0006342	GO-bp	Annotation by Michelle Graham. GO Biological Process: chromatin silencing	SoyBase	N/A	ISS
GO:0006346	GO-bp	Annotation by Michelle Graham. GO Biological Process: methylation-dependent chromatin silencing	SoyBase	N/A	ISS
GO:0008283	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell proliferation	SoyBase	N/A	ISS
GO:0009909	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of flower development	SoyBase	N/A	ISS
GO:0010267	GO-bp	Annotation by Michelle Graham. GO Biological Process: production of ta-siRNAs involved in RNA interference	SoyBase	N/A	ISS
GO:0010389	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of G2/M transition of mitotic cell cycle	SoyBase	N/A	ISS
GO:0016458	GO-bp	Annotation by Michelle Graham. GO Biological Process: gene silencing	SoyBase	N/A	ISS
GO:0016570	GO-bp	Annotation by Michelle Graham. GO Biological Process: histone modification	SoyBase	N/A	ISS
GO:0031047	GO-bp	Annotation by Michelle Graham. GO Biological Process: gene silencing by RNA	SoyBase	N/A	ISS
GO:0031048	GO-bp	Annotation by Michelle Graham. GO Biological Process: chromatin silencing by small RNA	SoyBase	N/A	ISS
GO:0034968	GO-bp	Annotation by Michelle Graham. GO Biological Process: histone lysine methylation	SoyBase	N/A	ISS
GO:0035196	GO-bp	Annotation by Michelle Graham. GO Biological Process: production of miRNAs involved in gene silencing by miRNA	SoyBase	N/A	ISS
GO:0048449	GO-bp	Annotation by Michelle Graham. GO Biological Process: floral organ formation	SoyBase	N/A	ISS
GO:0051276	GO-bp	Annotation by Michelle Graham. GO Biological Process: chromosome organization	SoyBase	N/A	ISS
GO:0051322	GO-bp	Annotation by Michelle Graham. GO Biological Process: anaphase	SoyBase	N/A	ISS
GO:0051567	GO-bp	Annotation by Michelle Graham. GO Biological Process: histone H3-K9 methylation	SoyBase	N/A	ISS
GO:0051607	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response to virus	SoyBase	N/A	ISS
GO:0051726	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of cell cycle	SoyBase	N/A	ISS
GO:0000796	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: condensin complex	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005694	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chromosome	SoyBase	N/A	ISS
GO:0005215	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transporter activity	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
UniRef100_I1M0W9	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Structural maintenance of chromosomes protein n=1 Tax=Glycine max RepID=I1M0W9_SOYBN	SoyBase	E_val: 2.00E-42	ISS
UniRef100_UPI0002339A1D	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI0002339A1D related cluster n=1 Tax=unknown RepID=UPI0002339A1D	SoyBase	E_val: 4.00E-52	ISS

Expression Patterns of Glyma02g06781

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g06781 not represented in the dataset	Glyma02g06781 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g06781 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.02g060600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma02g06781

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma02g06781

Limit To All Plant Sequences

>Glyma02g06781.1   sequence type=CDS   gene model=Glyma02g06781   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAATCTCTGTCAGAGAAGGTAGATGCACTTTCCCAGAATCTTGTGAGGGAAACGTCTGTACTAAATAATAAAGAAGACACTTTGAGGAGTGAAGAAGCCAACAAAGCAAATCTTGTTAAAAATATTGAAGAATTGAAGCATTCTGGAAAAGAGAAGTCCTCTGCTGTTAAAAAGGCTGAAGAGGGGGCAGCAGATCTGAAAAAGAAAGTTGATGAGCTCACAAAGAGTCTAGAGGAGCATGATAAAGAATACCAGGTAAAGGCTTAA

Predicted protein sequences of Glyma02g06781

Limit To All Plant Sequences

>Glyma02g06781.1   sequence type=predicted peptide   gene model=Glyma02g06781   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKSLSEKVDALSQNLVRETSVLNNKEDTLRSEEANKANLVKNIEELKHSGKEKSSAVKKAEEGAADLKKKVDELTKSLEEHDKEYQVKA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain