SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g06490): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g06490): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g06490

Feature Type:gene_model
Chromosome:Gm02
Start:5164245
stop:5166795
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma02g06490
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G05610AT Annotation by Michelle Graham. TAIR10: alfin-like 1 | chr5:1677331-1678942 REVERSE LENGTH=241 SoyBaseE_val: 1.00E-62ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
GO:0035064GO-mf Annotation by Michelle Graham. GO Molecular Function: methylated histone residue binding SoyBaseN/AISS
PTHR23123Panther PHD/F-BOX CONTAINING PROTEIN JGI ISS
PF12165PFAM Domain of unknown function (DUF3594) JGI ISS
UniRef100_D9ZIL9UniRef Annotation by Michelle Graham. Most informative UniRef hit: ALF domain class transcription factor n=1 Tax=Malus x domestica RepID=D9ZIL9_MALDO SoyBaseE_val: 2.00E-72ISS
UniRef100_UPI0002336BB4UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002336BB4 related cluster n=1 Tax=unknown RepID=UPI0002336BB4 SoyBaseE_val: 2.00E-110ISS

Expression Patterns of Glyma02g06490
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g06490 not represented in the dataset
Glyma02g06490 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g06490 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g058300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma02g06490
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma02g06490
>Glyma02g06490.2   sequence type=CDS   gene model=Glyma02g06490   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTCCAAACCTGGCACTGTAGAAGAGATCTTCAAGGACTATAGCGCCCGAAGAATCGCTATTATCCGTGCACTCACTCATGATGTTGATAAACTTTACGGGCTCTGTGATCCAGGAAAGGAGAATTTGTGCCTCTATGGACATCCGAATAAGGCTTGGGAAGTAACTCTGCCATCAGAGGAAGTTCCACCAGAGCTCCCTGAGCCAACTCTTGGAATCAATTTTGCTAGGGATGATGTGAGTCGCAGGGATTGGATTTCTTTGGTTGCTGTGCATAGTGATTCGTGGTTGCTTTCTCTGGCCTTTTACCTTGGAATTCGTCTTAACCACAATGAAAGAAAACGCTTATTTGGTTTGATCAACATTCTTCCCACCATTTTTCAAGTTGTGACCGACAATAAACCAATTAAGGACAATCCTACTATGGATAGTGGAAGCAAATTTCGGGGAAACACCGAGGTTAGTGTTTTCCTTTATCTAGTGATATTAGATAGTTCAATGCTAAAGTTTCATAGAATAAAAGTAATAATTAAAGTGAACATATCAATGTCATTATTTAAAAAAAAAAAAAGTATGATGGTTTTTGTTTGA
Predicted protein sequences of Glyma02g06490
>Glyma02g06490.2   sequence type=predicted peptide   gene model=Glyma02g06490   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASKPGTVEEIFKDYSARRIAIIRALTHDVDKLYGLCDPGKENLCLYGHPNKAWEVTLPSEEVPPELPEPTLGINFARDDVSRRDWISLVAVHSDSWLLSLAFYLGIRLNHNERKRLFGLINILPTIFQVVTDNKPIKDNPTMDSGSKFRGNTEVSVFLYLVILDSSMLKFHRIKVIIKVNISMSLFKKKKSMMVFV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo