Glyma02g06450 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g06450): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g06450): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g06450

Feature Type:	gene_model
Chromosome:	Gm02
Start:	5134672
stop:	5138151
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma02g06450

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G36660	AT	Annotation by Michelle Graham. TAIR10: Protein of unknown function (DUF1195) \| chr4:17285953-17287281 REVERSE LENGTH=179	SoyBase	E_val: 4.00E-59	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005794	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PF06708	PFAM	Protein of unknown function (DUF1195)	JGI		ISS
UniRef100_B9S6G4	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Sugar transporter, putative n=1 Tax=Ricinus communis RepID=B9S6G4_RICCO	SoyBase	E_val: 4.00E-54	ISS
UniRef100_UPI0002337161	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI0002337161 related cluster n=1 Tax=unknown RepID=UPI0002337161	SoyBase	E_val: 2.00E-108	ISS

Expression Patterns of Glyma02g06450

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g06450 not represented in the dataset	Glyma02g06450 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g06450 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.02g057900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma02g06450

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma02g06450

Limit To All Plant Sequences

>Glyma02g06450.1   sequence type=CDS   gene model=Glyma02g06450   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGGATAAGGAGACATTCCCTATTGCGAAAAAGGAAGCCTCTGATTCAGGTTTATTCGGAAGAGGAAGCTACAAATTCTGGGCACTAGCTGCCATGCTGCTCTTGGCATTCTGGTCCATGTTCACCGGCACAGTCTCTCTCCGCTGGTCCGGCACCCTCAACACTTTCTCCCACGCGTCCCTTCACGACCACCTCGACGTCCTCGAAATCGAGGAGCGGGAGAAGCTGGTGAGGCACATGTGGGACGTGTACACGAATAACCGTAGGATCAGGTTGCCGCGGTTCTGGGAAAAGGCCTTCGAGGCTGCCTACGAGGATTTGACCAGCGACGCCGCCGATGTTAGAGACGTTGCCGTCGCCGAGATCGTTAACATGTCTCTGCGCTCCTTGGATCTCCAATTGCCTCCTAGAGCACGGAAACTTAGTAAGAATCTCAAGGAAGTTGAGAAAGGCAAAGGAGCAACCTCCGAACGTGCTTAG

Predicted protein sequences of Glyma02g06450

Limit To All Plant Sequences

>Glyma02g06450.1   sequence type=predicted peptide   gene model=Glyma02g06450   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKDKETFPIAKKEASDSGLFGRGSYKFWALAAMLLLAFWSMFTGTVSLRWSGTLNTFSHASLHDHLDVLEIEEREKLVRHMWDVYTNNRRIRLPRFWEKAFEAAYEDLTSDAADVRDVAVAEIVNMSLRSLDLQLPPRARKLSKNLKEVEKGKGATSERA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain