SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g06240): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g06240): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g06240

Feature Type:gene_model
Chromosome:Gm02
Start:4969587
stop:4973226
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma02g06240
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G39250AT Annotation by Michelle Graham. TAIR10: RAD-like 1 | chr4:18271457-18271857 REVERSE LENGTH=100 SoyBaseE_val: 1.00E-26ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
PTHR25040Panther FAMILY NOT NAMED JGI ISS
PTHR25040:SF162Panther JGI ISS
UniRef100_G7LDY7UniRef Annotation by Michelle Graham. Most informative UniRef hit: MYB transcription factor MYB164 n=1 Tax=Medicago truncatula RepID=G7LDY7_MEDTR SoyBaseE_val: 1.00E-39ISS
UniRef100_I1JCP4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JCP4_SOYBN SoyBaseE_val: 3.00E-47ISS

Expression Patterns of Glyma02g06240
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g06240 not represented in the dataset
Glyma02g06240 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g06240 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g055900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma02g06240
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma02g06240
>Glyma02g06240.1   sequence type=CDS   gene model=Glyma02g06240   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCATCATCTTGGACTCCACGGCAGAACAAATTGTTTGAACAAGCCCTGGCTTTATATGACAGGGAAACCCCTGACAGATGGCAGAATGTGGCCAATGTGGTGGGAAGATCAGTTGAGGATGTTAAAAGGCACTATGAGATCCTCAAAGAAGATGTCAAACGCATTGAACATGGCCAAGTTCCATTTCCTCGTTACAAAACCAACACCAGCAACAACTAA
Predicted protein sequences of Glyma02g06240
>Glyma02g06240.1   sequence type=predicted peptide   gene model=Glyma02g06240   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASSWTPRQNKLFEQALALYDRETPDRWQNVANVVGRSVEDVKRHYEILKEDVKRIEHGQVPFPRYKTNTSNN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo