Glyma02g05990 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g05990): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g05990): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g05990

Feature Type:	gene_model
Chromosome:	Gm02
Start:	4813424
stop:	4816311
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma02g05990

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G66410	AT	Annotation by Michelle Graham. TAIR10: phosducin-like protein 3 homolog \| chr5:26519909-26521459 FORWARD LENGTH=230	SoyBase	E_val: 3.00E-123	ISS
GO:0000280	GO-bp	Annotation by Michelle Graham. GO Biological Process: nuclear division	SoyBase	N/A	ISS
GO:0000910	GO-bp	Annotation by Michelle Graham. GO Biological Process: cytokinesis	SoyBase	N/A	ISS
GO:0000911	GO-bp	Annotation by Michelle Graham. GO Biological Process: cytokinesis by cell plate formation	SoyBase	N/A	ISS
GO:0007000	GO-bp	Annotation by Michelle Graham. GO Biological Process: nucleolus organization	SoyBase	N/A	ISS
GO:0043622	GO-bp	Annotation by Michelle Graham. GO Biological Process: cortical microtubule organization	SoyBase	N/A	ISS
GO:0045454	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell redox homeostasis	SoyBase	N/A	ISS
GO:0051211	GO-bp	Annotation by Michelle Graham. GO Biological Process: anisotropic cell growth	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0048487	GO-mf	Annotation by Michelle Graham. GO Molecular Function: beta-tubulin binding	SoyBase	N/A	ISS
KOG1672	KOG	ATP binding protein	JGI		ISS
PTHR21148	Panther	PHOSDUCIN-RELATED	JGI		ISS
PTHR21148:SF14	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF00085	PFAM	Thioredoxin	JGI		ISS
UniRef100_G7LDV7	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Thioredoxin domain-containing protein n=2 Tax=Medicago truncatula RepID=G7LDV7_MEDTR	SoyBase	E_val: 5.00E-130	ISS
UniRef100_I1JCM1	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1JCM1_SOYBN	SoyBase	E_val: 1.00E-167	ISS

Expression Patterns of Glyma02g05990

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g05990 not represented in the dataset	Glyma02g05990 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma02g05990 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.02g053300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma02g05990

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma02g05990

Limit To All Plant Sequences

>Glyma02g05990.2   sequence type=CDS   gene model=Glyma02g05990   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATCCAAACACGGTGAAGTCCACTCTCTCCAATCTGGCGTTTGGAAACGTAATGGCAGCAGCTGCCCGTGATTATCAGAAGGAATTGCTTGCTCAAGAGAAGACTCAAGGATCAAGTTCAGTACATGAGGAGGTTGACCTTGACGAGTTAATGGATGATCCTGAGTTAGAAAAATTGCATGCAGATAGGATTGCAGCTCTTAAGAAAGAAGCAGAGAAACGGGAGGAATGGAAGAAGAAAGGTCATGGGGAATTCAGGGAAGTAACCGAGGGTGATTTCTTAGGTGAAGTCACTGGAAGTGAAAAAGTGATTTGTCACTTCTACCATAGGGAGTTCTATAGATGCAAGATAATGGATAAGCATTTAAAGTCTCTTGCACCAATGCATATTGATACGAAGTTCATCAAGCTTGATGCAGAGAATGCACCATTCTTTGTTACAAAACTGGCTATCAAGACTTTGCCTTGTGTCTTGTTGTTCAGACAAGGAGTAGCAGTAGATAGATTGGTAGGATTTCAAGATGTGGGAGGTAAAGATGATTTTACCACAAGAACGCTGGAAGCTCTTCTGATAAAGAAAGGTATAATTGAGGAGAAGAAAGCTGAGGATGATGAAGATGATGAATATATAGACAGTACACGTAGAGTCGTTAGATCCTCCACAATTGCTGGTTCTGATTCTGATTCTGAATAA

Predicted protein sequences of Glyma02g05990

Limit To All Plant Sequences

>Glyma02g05990.2   sequence type=predicted peptide   gene model=Glyma02g05990   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDPNTVKSTLSNLAFGNVMAAAARDYQKELLAQEKTQGSSSVHEEVDLDELMDDPELEKLHADRIAALKKEAEKREEWKKKGHGEFREVTEGDFLGEVTGSEKVICHFYHREFYRCKIMDKHLKSLAPMHIDTKFIKLDAENAPFFVTKLAIKTLPCVLLFRQGVAVDRLVGFQDVGGKDDFTTRTLEALLIKKGIIEEKKAEDDEDDEYIDSTRRVVRSSTIAGSDSDSE*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain