Glyma02g05870 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma02g05870): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma02g05870): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma02g05870

Feature Type:	gene_model
Chromosome:	Gm02
Start:	4730071
stop:	4735350
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma02g05870

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G17280	AT	Annotation by Michelle Graham. TAIR10: CONTAINS InterPro DOMAIN/s: Oxidoreductase-like, N-terminal (InterPro:IPR019180); Has 1807 Blast hits to 1807 proteins in 277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339 (source: NCBI BLink). \| chr5:5686355-5686762 FORWARD LENGTH=135	SoyBase	E_val: 2.00E-14	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PTHR11698	Panther	UNCHARACTERIZED	JGI		ISS
PF09791	PFAM	Oxidoreductase-like protein, N-terminal	JGI		ISS
UniRef100_C6T570	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T570_SOYBN	SoyBase	E_val: 2.00E-80	ISS
UniRef100_Q9FFI3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: AT5g17280/MKP11_13 n=1 Tax=Arabidopsis thaliana RepID=Q9FFI3_ARATH	SoyBase	E_val: 1.00E-11	ISS

Expression Patterns of Glyma02g05870

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma02g05870 not represented in the dataset	Glyma02g05870 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma02g05870

Paralog	Evidence	Comments
Glyma16g24560	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma02g05870 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.02g052200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma02g05870

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma02g05870

Limit To All Plant Sequences

>Glyma02g05870.1   sequence type=CDS   gene model=Glyma02g05870   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGAACTACAGCACCTTCCGATTTCATTTTCACCCAAAAGCTTCACCCTTTCAACATCACCTCCACCAAAACCTCCCTCCAACGAACCCTACCCTATTTTCTCCAACTCAATCGCATGGCCGAGGCTGCACGAACCGCGCATAAACCCGCGCCGCACCCGATCCAACCCAAACCCGACGATAAAACCCCGAATCCGGCGAAGGAGATTCCGCCGCCGCCGGAGAAGCCGGAGCCCGGCGATTGCTGCGGCAGCGGGTGCGTCCGATGCGTCTGGGATGTGTACTACGACGAACTCGAAGAATACAATAAGCGATACAAACAGGTCGATCCCAGCCCCAAACCTTCTTCGTAA

Predicted protein sequences of Glyma02g05870

Limit To All Plant Sequences

>Glyma02g05870.1   sequence type=predicted peptide   gene model=Glyma02g05870   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MRTTAPSDFIFTQKLHPFNITSTKTSLQRTLPYFLQLNRMAEAARTAHKPAPHPIQPKPDDKTPNPAKEIPPPPEKPEPGDCCGSGCVRCVWDVYYDELEEYNKRYKQVDPSPKPSS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain